KEGG   Trichechus manatus latirostris (Florida manatee): 101355243Help
Entry
101355243         CDS       T05135                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu04068  FoxO signaling pathway
tmu04070  Phosphatidylinositol signaling system
tmu04071  Sphingolipid signaling pathway
tmu04115  p53 signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04510  Focal adhesion
tmu04931  Insulin resistance
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05222  Small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05230  Central carbon metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101355243
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101355243
   04070 Phosphatidylinositol signaling system
    101355243
   04071 Sphingolipid signaling pathway
    101355243
   04151 PI3K-Akt signaling pathway
    101355243
   04150 mTOR signaling pathway
    101355243
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101355243
  09143 Cell growth and death
   04115 p53 signaling pathway
    101355243
   04218 Cellular senescence
    101355243
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101355243
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355243
   05206 MicroRNAs in cancer
    101355243
   05230 Central carbon metabolism in cancer
    101355243
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101355243
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101355243
   05214 Glioma
    101355243
   05218 Melanoma
    101355243
   05215 Prostate cancer
    101355243
   05213 Endometrial cancer
    101355243
   05224 Breast cancer
    101355243
   05222 Small cell lung cancer
    101355243
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101355243
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101355243
   05165 Human papillomavirus infection
    101355243
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101355243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmu01009]
    101355243
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101355243
    3.1.3.48  protein-tyrosine-phosphatase
     101355243
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101355243
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101355243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 101355243
NCBI-ProteinID: XP_004369959
UniProt: A0A2Y9D8M5
LinkDB All DBs
Position
Unknown
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSTSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaacattattgctatggggtttcctgcagaa
agacttgaaggtgtatacaggaacaacattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgacaccgctaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagagctt
atcaaacccttttgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttgtta
catcggggcaaatttttaaaggcacaagaggccctagatttttatggggaagtaaggacc
agagacaaaaagggagtaactattcccagtcagaggcgctatgtatattattatagctac
ctgttaaagaatcatctggattatagaccagtggcactgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctctacttcaggacccacacgacgggaagacaagttcatgtac
tttgaattccctcagccgttgcctgtgtgtggtgacatcaaagtagagttcttccacaaa
cagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaatacattcttcata
ccaggaccagaggaaacctcagaaaaagtagaaaatggaagtctatgtgatcaagaaatt
gatagtatttgcagtatagagcgtgcagataatgacaaggaatatctagtacttacttta
acaaaaaatgatcttgacaaggcaaataaagacaaggccaaccgatacttttctccaaat
tttaaggtgaagctgtatttcacaaaaacagtagaggagccatcaaatccagaggctagc
agttcaacttctgtaacgccagatgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagagaatgaaccttttgatgaagatcagcatacacaaatt
acaaaagtctga

DBGET integrated database retrieval system