KEGG   Trichechus manatus latirostris (Florida manatee): 101355276
Entry
101355276         CDS       T05135                                 

Definition
(RefSeq) cyclin-dependent kinase 4 isoform X1
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04530  Tight junction
tmu04660  T cell receptor signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101355276
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101355276
   04115 p53 signaling pathway
    101355276
   04218 Cellular senescence
    101355276
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101355276
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101355276
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355276
   05203 Viral carcinogenesis
    101355276
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101355276
   05225 Hepatocellular carcinoma
    101355276
   05214 Glioma
    101355276
   05220 Chronic myeloid leukemia
    101355276
   05218 Melanoma
    101355276
   05219 Bladder cancer
    101355276
   05224 Breast cancer
    101355276
   05222 Small cell lung cancer
    101355276
   05223 Non-small cell lung cancer
    101355276
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101355276
   04934 Cushing syndrome
    101355276
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101355276
   05160 Hepatitis C
    101355276
   05164 Influenza A
    101355276
   05162 Measles
    101355276
   05163 Human cytomegalovirus infection
    101355276
   05167 Kaposi sarcoma-associated herpesvirus infection
    101355276
   05169 Epstein-Barr virus infection
    101355276
   05165 Human papillomavirus infection
    101355276
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101355276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101355276
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101355276
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101355276
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 101355276
NCBI-ProteinID: XP_023590295
UniProt: A0A2Y9R476
LinkDB
Position
Unknown
AA seq 381 aa
MDSRGIFLFYKLSHGWRGFYCYLGTSHGRLGRVWDTGVVFMMLFVGVALLLQTLTTLTLE
GDFDSWSLCDCRVSPDLRMATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNG
GGTGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRT
YLDKAPPPGLPVETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLA
RIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQ
LGKIFDLIGLPPEDDWPRDVSLPRGAFSPRGPRPVQSVVPEVEESGAQLLLEMLTFNPHK
RISAFRALQHSYLQKGEGNPE
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggactcaagaggcatttttttattctacaagctctcacatggctggaggggtttttat
tgttacctggggaccagccatggaaggttggggagggtatgggatactggtgttgtcttt
atgatgctttttgtgggagtcgctttgttgctgcagactcttacaaccctaactctggaa
ggggattttgatagttggagtctctgtgattgtagggtctcccctgatctgagaatggcc
accccgcgatatgagccagtggctgagattggtgtcggtgcctatgggacggtgtacaaa
gctcgtgatccccacagtggccactttgtggctctcaagagcgtgagagtccccaatgga
gggggcactggagggggccttcctatcagcacagttcgtgaagtggcgttattgaggcgg
ctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccacagcccga
actgatcgggaaaccaaggtaaccctggtatttgaacatgtggaccaagacctaaggaca
tatctagacaaagcacccccaccaggcttgcctgtggagaccatcaaggatctgatgcgc
cagtttctaagaggccttgatttcctgcatgccaattgcattgttcaccgagacctgaag
ccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggcctggcc
agaatctacagctaccagatggcacttacacctgtggttgttacactctggtaccgtgct
cctgaagttcttctgcaatctacgtatgcaactcctgtagacatgtggagcgtaggctgt
atctttgcagaaatgtttcgtcggaagcctctcttctgtggaaactctgaagctgaccag
ttaggcaaaatttttgatctgatcgggctgcccccggaagatgactggccccgagacgtg
tctttaccccgaggagccttttcccctagagggccccgcccagtgcagtcggtggtgcct
gaggtggaggaatctggagcacagctgctgctggaaatgctgacttttaacccacacaag
cgaatctctgccttccgagccctgcagcactcttatctacaaaagggagaaggtaatcca
gagtga

DBGET integrated database retrieval system