KEGG   Trichechus manatus latirostris (Florida manatee): 101355353Help
Entry
101355353         CDS       T05135                                 

Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04210  Apoptosis
tmu04380  Osteoclast differentiation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04622  RIG-I-like receptor signaling pathway
tmu04623  Cytosolic DNA-sensing pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04926  Relaxin signaling pathway
tmu04931  Insulin resistance
tmu05134  Legionellosis
tmu05135  Yersinia infection
tmu05140  Leishmaniasis
tmu05142  Chagas disease (American trypanosomiasis)
tmu05145  Toxoplasmosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101355353
   04668 TNF signaling pathway
    101355353
   04024 cAMP signaling pathway
    101355353
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101355353
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101355353
   04621 NOD-like receptor signaling pathway
    101355353
   04622 RIG-I-like receptor signaling pathway
    101355353
   04623 Cytosolic DNA-sensing pathway
    101355353
   04625 C-type lectin receptor signaling pathway
    101355353
   04660 T cell receptor signaling pathway
    101355353
   04658 Th1 and Th2 cell differentiation
    101355353
   04659 Th17 cell differentiation
    101355353
   04657 IL-17 signaling pathway
    101355353
   04662 B cell receptor signaling pathway
    101355353
   04062 Chemokine signaling pathway
    101355353
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101355353
   04926 Relaxin signaling pathway
    101355353
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101355353
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101355353
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355353
   05203 Viral carcinogenesis
    101355353
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101355353
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101355353
   05215 Prostate cancer
    101355353
   05222 Small cell lung cancer
    101355353
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101355353
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101355353
   05134 Legionellosis
    101355353
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101355353
   05170 Human immunodeficiency virus 1 infection
    101355353
   05162 Measles
    101355353
   05164 Influenza A
    101355353
   05161 Hepatitis B
    101355353
   05160 Hepatitis C
    101355353
   05168 Herpes simplex virus 1 infection
    101355353
   05163 Human cytomegalovirus infection
    101355353
   05167 Kaposi sarcoma-associated herpesvirus infection
    101355353
   05169 Epstein-Barr virus infection
    101355353
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101355353
   05140 Leishmaniasis
    101355353
   05142 Chagas disease (American trypanosomiasis)
    101355353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101355353
   04131 Membrane trafficking [BR:tmu04131]
    101355353
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101355353
Membrane trafficking [BR:tmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101355353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4 SNN_linker
Motif
Other DBs
NCBI-GeneID: 101355353
NCBI-ProteinID: XP_004376567
UniProt: A0A2Y9DL46
LinkDB All DBs
Position
Unknown
AA seq 314 aa AA seqDB search
MFQPAEHSQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAQVLLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQNCPTQHLHSILQATN
YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTPENLQRLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLAL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcccgccgagcactcccaggagtgggccatggagggcccccgggacgggctg
aaaaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgcgagatccgcctagagccgcaggaggcgccc
cgcggagcggagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgacgatggaagtgatccgccaagtgaagggagac
ctggctttcctcaacttccagaacaacctgcagcagactccactgcacttggctgtgatc
accaaccagccagaaattgctcaggttcttctgggagctggctgtgatcctgagctgcga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg
ggagttctgacacagaactgccccacccagcatctccactccatcctgcaggccaccaac
tacaatggtcacacgtgtctgcacttggcctctatccatggctatctgggcatcgtggag
catttggtgtccctgggtgccgacgtcaacgctcaggagccctgtaatggccggactgcc
ctccacctcgcagtggacctgcagaatcctgacctggtgtcgctcttgttgaagtgtggg
gctgacgtcaacagagttacctaccagggctactctccataccagctcacctggggccgc
ccaagcacccggatacagcaacagctgggccagctgaccccggaaaacctgcagaggctg
ccagagagtgaagatgaggagagctatgacacggagtcagagttcacagaggatgagctg
ccctatgatgactgtgtgcttggaggccagcgcctggcattatga

DBGET integrated database retrieval system