KEGG   Trichechus manatus latirostris (Florida manatee): 101355462Help
Entry
101355462         CDS       T05135                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101355462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101355462
NCBI-ProteinID: XP_012412914
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MEKQEEYLGEKEVNNNRLERVKVTEVDWQQQRNGAAHHTQEFPGPYLVVRRGQMFTITVN
FSRALESQETLIFTVETGPQASEALHTKAVFQTSETEAGTAWRAIQEAQSENTRTVSLTS
PPDAVIGLYWLSASVSSRRKHSNRKLGEFVLLFNPWCPEDDVFLASEEERQEYVLNDSGI
IFRGVEKHIQAQGWNYGQFEEDILNICLSILDRSPSHQDNPATDVSRRHDPIYVTRVISA
MVNSNNDRGVVQGQWQGKYGSGTSPLHWQGSVAILQKWFKGRYKPVRYGQCWVFAGVMCT
VLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQ
DLGPTYNGWQVLDATPQEESKGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWL
WHEDESRERVYSDTKKIGRCISTKAMGSDSRVDITGLYKYPEGSKKERQVYRKAVRKLFS
VESCGRRNRIRRAGRRGLWRDDLLEPATKPSITGNFKLLEPPVLGHDLRLALCLANLTSR
ARRVRVNLNGATILYTRRPVAEILHESHAVQLGPKEEKKIPVTISYSQYKKDLTEDRKIL
LAAMCLVTKGEKLLVEKDITLEDFITIKLQGPAMVGVAVVVEVMVVNPLLERVEDCSLMA
EGSGLLRGQLSIDVPSLEPQERASVQFSITPSRSGPRQLQVGLVSSRFPDIKDFVIIHVA
AAK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacaagaggagtatttgggggagaaagaagtgaacaacaacagactggaaagg
gtcaaagtcactgaggtggactggcagcagcagaggaatggcgctgcccaccacacccag
gagttccccggcccctatctggtggtccgcaggggccagatgttcactatcacagtgaat
ttcagcagagccttggagagccaggagaccctcatcttcacggtggagacaggaccccag
gcttctgaggcccttcacaccaaagctgtgttccagacatcggagacggaggccggcact
gcctggagagccatccaggaagctcagagtgagaacacccggactgtcagcctcaccagc
cctcctgatgctgtcattggcctctactggctaagtgccagtgtctcctcccgccgcaag
cacagcaacaggaagctgggcgagtttgttctccttttcaacccgtggtgcccagaggat
gacgtgtttctggcctcggaggaggagcgacaggagtacgtgctcaacgacagtgggatc
atcttccgaggcgtggagaagcacatccaagcccaaggctggaactacgggcagtttgag
gaggacatcctgaacatctgcctctccatcctggaccgaagccccagtcaccaagacaac
ccagccaccgacgtgtcccgccgccatgaccccatctacgtcaccagggtcatcagtgcc
atggtgaacagcaacaatgatcgaggcgtggtccaaggccagtggcagggcaagtacggc
agcggcaccagcccactgcactggcaaggcagtgtggccattctgcagaagtggttcaag
ggccggtacaagccagtcagatacggccagtgctgggtcttcgctggagtcatgtgcaca
gtccttaggtgcctggggatcgccacgagggttgtgtccaacttcaactcagcccacgac
acggacaggaacctgagtgtggacaaatacgtggactccttcggccggaccctggaggac
ctgacagaggacagcatgtggaatttccacgtctggaacgagagctggtttgctcggcag
gacctaggccccacttacaatggctggcaggttctggatgcgaccccccaggaagagagc
aaaggagtgttccggtgtggcccagcctcagtcaccgccatccgtgagggcgacgtgcac
ctggcccacgatggcccctttgtgtttgcggaggtcaacgcggactacatcacctggctc
tggcacgaagacgagagccgggagcgtgtgtactcggacacgaagaagatcggaaggtgc
atcagcaccaaggcaatgggcagtgactcccgcgtggacatcacaggcctctacaagtac
ccggaagggtccaagaaggaaaggcaggtgtacaggaaggctgtgaggaagctgttcagc
gtggaatcctgcgggcggagaaaccggattcgcagggccggaaggcgtggtctctggcgt
gacgacctcctggagcccgccacgaagcccagcatcaccggcaacttcaagctgctggag
ccacctgtcctgggccacgatctgaggctggccctgtgcctggccaacctcacttcccgg
gcccggagggtccgcgtcaacctgaacggtgccactatcctctacacccgcaggccggtg
gcagagattctgcacgaatcccatgcagtgcagctggggcccaaggaagagaaaaagatc
ccagtcacaatatcttactctcagtataagaaagacctgacagaggacaggaagatcctg
ttggctgccatgtgtctcgtcaccaaaggagagaagctcctggtggagaaggacattact
ctggaggacttcatcaccatcaagttgcagggcccagccatggtgggggtggcagttgtg
gtggaagtgatggtggtcaaccccctcttggagagagtggaggactgttcgctgatggcg
gagggaagtggcctgctccggggacaactcagcatcgatgtgcccagcctggagcctcag
gagagggcctcggtccagttcagcatcaccccctctaggagtggcccaaggcagctgcag
gtgggccttgtcagctcccgcttcccagatatcaaggactttgtgatcatccatgtggcc
gccgctaagtga

DBGET integrated database retrieval system