KEGG   Trichechus manatus latirostris (Florida manatee): 101355539Help
Entry
101355539         CDS       T05135                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00500  Starch and sucrose metabolism
tmu01100  Metabolic pathways
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04910  Insulin signaling pathway
tmu04922  Glucagon signaling pathway
tmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101355539
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101355539
   04152 AMPK signaling pathway
    101355539
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101355539
   04922 Glucagon signaling pathway
    101355539
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101355539
Enzymes [BR:tmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101355539
Glycosyltransferases [BR:tmu01003]
 Polysaccharide
  Storage polysaccharide
   101355539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 101355539
NCBI-ProteinID: XP_004381728
LinkDB All DBs
Position
Unknown
AA seq 737 aa AA seqDB search
MPLSRSLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHIVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDNEAGERQIYH
RYCMERAATHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDSLPDEDGERYDEEEEAAKDRRNIRTPEWQRRASSASSTSGSKRSSVDTAPSSTLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgccactaagccgcagtttgtccatgtcctcactgccaggactggaggactgggaggat
gagttcgacctggagaacacggtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggccaaggtgacaggggatgagtggggtgac
aactactacctggtggggccatacacggagcagggagtgaggacccaggtggaacttctc
gagccccccaccccggccctgaagaggaccctggactccatgaacagcaagggctgcaag
gtgtattttgggcgctggctgatcgagggggggcccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccatggtacgaccgtgaggccaacgacgctgtcctctttggcttcctcaccacctgg
ttcctgggtgagtttctggcccagagtgaggagaagccacatattgttgcacactttcac
gagtggttggcgggcgtcgggctttgcctgtgccgagccaggcggctgcccgtggctacc
atctttaccacccatgccacgctgctggggcgttacctgtgtgctggtgctgtggacttc
tacaacaacctggagaatttcaatgtggacaacgaagcaggtgagaggcagatttatcac
cgctactgcatggagcgagcggccacccactgtgctcatgtcttcactactgtctcccag
atcactgccatcgaggctcagcacctcctcaagaggaaaccagatattgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcacgagttccagaaccttcatgcccagagc
aaggctcgaatccaggagtttgttcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttatcgccggccggtacgagttctccaacaagggggccgac
gtcttcctggaggccttggccaggctcaactatcttcttagagtgaatggcagtgaacag
acagtggtcgccttcttcatcatgccggctcggaccaacaatttcaatgtggaaacgctc
aagggccaagcggtccgcaagcagctttgggacacggccaacacagtgaaggagaagttc
gggaggaagctttatgagtctttgctggtgggaagcctcccagacatgaacaaaatgctg
gacaaggaggacttcacgatgatgaagagagccatctttgccacgcagcggcagtccttc
ccccctgtgtgcacccacaatatgctggatgactcgtcagaccctatcctgaccaccatc
cgccgaattggcctcttcaatagcagtgctgacagggtcaaggtaattttccacccggaa
ttcctctcctccacgagccccctgctccctgtggactatgaggagtttgtccgaggctgc
cacctaggagttttcccctcttactatgagccttggggctatacgccagctgagtgcacc
gttatgggcatccccagtgtctccaccaacctctctggctttggctgcttcatggaggag
cacatcgcagacccctcagcttatggcatctatattctggaccggcggttccgcagcttg
gacgattcgtgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaatcgcacggagcgcctctctgaccttctggattggaaatac
ctaggccggtactatatgtccgcgcgccacatggccctggccaaggcctttccggatcac
ttcacctacgaaccccacgaggcggatgcgacccagggctaccgctacccacggccggcc
tcggtgccaccatcaccctcgctgtcacgacactcgagcccacaccagagtgaggacgag
gaggagccccgcgactcactgccggacgaggacggcgagcgctacgacgaggaggaggag
gccgccaaagacaggcgcaacatccgcacccccgaatggcagcgccgcgcctcctccgcc
tcctccaccagtgggagcaagcgcagctcagtggacacagcaccctccagcactctcagc
acccccagcgagcccctcagccccgccagctctctgggtgaggaacgcaactag

DBGET integrated database retrieval system