KEGG   Trichechus manatus latirostris (Florida manatee): 101355667
Entry
101355667         CDS       T05135                                 

Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
tmu05226  Gastric cancer
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355667
   05202 Transcriptional misregulation in cancer
    101355667
  09162 Cancer: specific types
   05226 Gastric cancer
    101355667
   05221 Acute myeloid leukemia
    101355667
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101355667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101355667
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101355667
SSDB
Motif
Pfam: Arm HEAT Cnd1 Adaptin_N Atx10homo_assoc HEAT_2 DUF3361 PUL
Other DBs
NCBI-GeneID: 101355667
NCBI-ProteinID: XP_012415137
UniProt: A0A2Y9G1P7
LinkDB
Position
Unknown
AA seq 745 aa
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDDACARQYLLKKTTT
YTQGVPQNQGDLEYQMSTTARAKRVREAMCPGVTGEESSLLLATQVEGQTTNLQWLAEPS
QMLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVSVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLVRNLALCPANHAPLQEAAVIPRLVQLLIKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDVTYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaacctgattgaacagcccatcaaggtgaccgagtggcagcagacatac
acctatgattcgggcatccactcaggtgccaacacctgcgtgccctctgtcagcagcaag
ggcatcatggaggaggatgacgcctgcgcgcgccagtacctgctcaagaagaccaccacc
tacacgcagggtgtgccccagaaccaaggtgacctggagtaccagatgtccacaacggcc
agagccaagcgggtgcgggaggccatgtgtcctggcgtgacgggggaggagagctcgctg
ttgctggccacccaagtggaggggcagaccaccaacctgcagtggctggctgagccgtcc
cagatgctcaagtcggccattgtgcatctcatcaactaccaggatgacgctgagctggcc
acccgggccctgcccgagctcaccaaattgctcaacgatgaggacccggtggtggtgacc
aaggcggccatgattgtgaaccagctgtccaagaaggaggcatcgcggcgggccctgatg
ggctcaccccagctggtggcggccgtggtgcgcaccatgcagaacaccagcgacctggat
acagcccgctgtaccaccagcatcctgcacaacctctcccaccaccgtgaggggctgctt
gccatcttcaaatcaggcggcatccccgccctggtccgcatgcttagctccccggtggag
tcggtcctgttctacgccatcaccaccttgcacaacctgctgctctaccaggagggtgcc
aagatggcggtgcgcctggcggacgggctgcagaagatggtgcccctgctcaacaagaac
aaccctaagttcctggccatcaccaccgactgcctgcagctgctggcctatggcaaccag
gagagcaagctgatcattctggccaatggaggaccccaggccctcgtgcagatcatgcgc
aactatagttatgagaagctgctctggaccaccagccgtgtcctcaaggtgctgtccgtg
tgtcccagcaataagccagccattgtggaggctggtgggatgcaggccctgggcaagcac
ctgacaagcaacagcccacgcctggtgcagaactgcctctggaccctgcgcaacctctcg
gacgtggccactaagcaggagggcctggagagtgtgctgaagattctggtgaaccagctg
agtgtggatgatgtcagtgtcctcacctgtgccacgggcacgctctccaacctgacgtgc
aacaacagcaagaacaagacactggtgacgcagaacagcggtgtggaggctctcatccac
gccatcctgcgtgccggtgacaaggacgacatcacggagccggctgtctgcgccctgcgc
cacctcaccagccgccaccccgaggccgagatggcccagaactccgtgcgcctcaactat
ggcattccagccattgtcaagctgctcaaccagcccaaccaatggccactggtcaaggca
accattggcctggtcaggaatctggccctgtgcccagccaaccatgccccactgcaagag
gcagcagtcattccccgcctcgtccagctgctgatcaaggcccaccaggatgcccagcgc
catgtggctgcgggcacacagcagccctacacggatggtgtgaggatggaggagattgtg
gagggctgcaccggagccctgcatatccttgcccgtgatcccatgaaccgcatggagatc
ttccgactcaataccatccccctgtttgtgcagctcctgtactcatcagtggagaacatc
cagcgtgtggctgcaggagttctgtgcgagctggcccaggacaaggaggcagccgacgcc
attgatgctgagggggcctcggccccactcatggagctgctgcactcccgaaatgagggc
accgccacctacgccgctgccgtcctgttccgcatctctgaggacaagaacccagattac
cgcaagcgtgtgtcggtggagctcaccaactccctcttcaagcatgacccagctgcctgg
gaggctgcccagagcatgatccccatcaatgaaccctatgcagatgacatggatgtcacc
taccgccccatgtactcgagtgatgtgcccttggaccccctggagatgcacatggacatg
gacggggactaccccatcgacacctacagcgacggcctcaggcccccctaccccactgca
gaccacatgctggcctag

DBGET integrated database retrieval system