KEGG   Trichechus manatus latirostris (Florida manatee): 101355918
Entry
101355918         CDS       T05135                                 

Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04915  Estrogen signaling pathway
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05223  Non-small cell lung cancer
tmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101355918
   04012 ErbB signaling pathway
    101355918
   04014 Ras signaling pathway
    101355918
   04151 PI3K-Akt signaling pathway
    101355918
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101355918
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355918
  09162 Cancer: specific types
   05210 Colorectal cancer
    101355918
   05212 Pancreatic cancer
    101355918
   05225 Hepatocellular carcinoma
    101355918
   05214 Glioma
    101355918
   05211 Renal cell carcinoma
    101355918
   05215 Prostate cancer
    101355918
   05223 Non-small cell lung cancer
    101355918
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101355918
SSDB
Motif
Pfam: EGF_2 EGF Adeno_E3 Cortexin TMEM154 FAM176
Other DBs
NCBI-GeneID: 101355918
NCBI-ProteinID: XP_023588626
UniProt: A0A2Y9R582
LinkDB
Position
Unknown
AA seq 162 aa
MQGLPHPLKTGRVCGHFCLSCAMDLSLMPFLSPADPPVAAAVVSHFNDCPDSHSQFCFHG
TCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALGILIITC
VLIHCCQVRKHCEWCRALICWHEKPSALLKGRTACCHSETAV
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcagggcctgccacaccccctgaaaacggggagggtgtgcgggcacttctgtctcagc
tgtgccatggatctgagcctaatgccttttctctccccagcagacccgcctgtggccgcc
gctgtggtatcccattttaatgactgcccagattcccacagccagttctgcttccatgga
acctgtaggtttttggtgcaggaggacaagccagcttgtgtctgccattctgggtatgtc
ggtgcacgctgtgagcacgcagacctcctggctgtggtggccgccagtcagaagaagcag
gccatcaccgccttggtcgtagtctccattgtggccctgggtatcctcatcatcacgtgt
gtgctgatccactgctgccaggtccgaaagcactgtgagtggtgccgcgccctcatctgc
tggcatgagaagcccagtgcccttctgaagggaaggactgcctgctgccactcagaaaca
gcagtctga

DBGET integrated database retrieval system