KEGG   Trichechus manatus latirostris (Florida manatee): 101355952
Entry
101355952         CDS       T05135                                 

Definition
(RefSeq) retinoblastoma-associated protein isoform X3
  KO
K06618  retinoblastoma-associated protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05212  Pancreatic cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101355952
   04218 Cellular senescence
    101355952
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355952
   05203 Viral carcinogenesis
    101355952
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101355952
   05225 Hepatocellular carcinoma
    101355952
   05226 Gastric cancer
    101355952
   05214 Glioma
    101355952
   05220 Chronic myeloid leukemia
    101355952
   05218 Melanoma
    101355952
   05219 Bladder cancer
    101355952
   05215 Prostate cancer
    101355952
   05224 Breast cancer
    101355952
   05222 Small cell lung cancer
    101355952
   05223 Non-small cell lung cancer
    101355952
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101355952
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101355952
   05161 Hepatitis B
    101355952
   05160 Hepatitis C
    101355952
   05163 Human cytomegalovirus infection
    101355952
   05167 Kaposi sarcoma-associated herpesvirus infection
    101355952
   05169 Epstein-Barr virus infection
    101355952
   05165 Human papillomavirus infection
    101355952
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101355952
Protein phosphatases and associated proteins [BR:tmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101355952
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    101355952
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 101355952
NCBI-ProteinID: XP_004376636
UniProt: A0A2Y9DL89
LinkDB
Position
Unknown
AA seq 938 aa
MPPKTPRRAAAAAAAAAAAAAAAAAASVEPPAPPLPPPPEEDPEHDSGPEDLPLARLEFE
ETEDPDFVALCQKLKIPDHVRERAWLTWEKVSSMDGVLEGYIQKKKELWGVCIFIAAVDL
DEMPFTFTELQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCE
LIYLTQPSSSISSEINSALVLKLSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLS
PPALLKEPYRTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCTEQKCNIDEVKN
VYFKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPIDS
FEMQRTPRKSNPDEEVNMIPPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVN
PKESILKRVKDIGCIFKEKFARAVGQGCIEIGLQRYKLGVRLYYRVMESMLKSEEERLSI
QNFSKLLNDNIFHKSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYK
VIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPADHLESAC
TLNLPLQNNHTAADMYLSPVRSPKKKGPATRVNSTANAEAQATSATQTQKPLKSTSLSLF
YKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQYTLQNEYELMRDRHLDQIMMCSMYG
ICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQ
YASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSR
ILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSRH
LPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaagagcggctgctgccgccgctgcggctgctgccgctgcc
gccgctgccgccgccgcctctgtggaacccccggcgccgccgctgccgccccctcccgag
gaggatccggagcacgacagtggccccgaggacctgcctctggccaggcttgaatttgaa
gaaactgaagaccctgattttgttgcattgtgtcagaaattgaagataccagatcatgtc
agagaaagagcttggttaacttgggagaaagtttcatctatggatggtgtactggaaggt
tatattcaaaagaaaaaagaactgtggggagtctgtatcttcattgcagcagttgaccta
gatgaaatgccattcactttcactgagctacagaaaaacatagaaaccagtgtctataaa
ttctttgacttactaaaagaaatcgatacaagtaccaaagttgataatgctatgtcaaga
ctgttgaagaagtataacgtattatgtgcactctacagcaaattagaaaggacatgtgaa
cttatatatttgacacaacccagcagttcgatatcttctgaaataaattctgcattggtg
ctgaagctttcttggatcacatttttgctagctaaaggggaagtattacaaatggaagat
gatctcgtgatctcatttcagttaatgctgtgtgtccttgactattttatcaagctctca
ccccctgcattgcttaaagaaccatatagaacagctgtgatacctattaatggttcccct
cgaacaccaagacgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgat
acaagaattattgaagttctctgtacagagcagaaatgtaacatagatgaggtgaaaaat
gtttatttcaaaaattttataccttttatgaattctcttggaattgtagcttctaatgga
cttccagaggttgaaagtctctctaaacagtatgaagaaatttaccttaaaaataaagat
ctagatgcaagattatttttggatcatgacaaaactcttcaggctgatcctatagacagt
tttgaaatgcagagaacaccacgaaaaagtaaccctgatgaagaagtgaatatgattcct
ccacagactccagttaggactgttatgaatactattcagcaattaatgatgatcttaaat
tcagcaagtgatcaaccatcagaaaatctgatttcctattttaataactgcacagtgaat
ccaaaggaaagtatcctgaagagagtaaaggatattggctgcatctttaaagagaaattt
gctagagctgtgggacaaggatgtattgaaattggattacagcgatacaaacttggagtc
cgattgtattatcgagtaatggaatcaatgcttaaatcggaagaagaacgattatccatt
caaaactttagcaaactcctgaatgacaacatctttcataagtctttgttggcatgcgct
cttgaggttgtaatggctacatatagcagaagtacatctcagaatcttgattctggaaca
gatttgtccttcccatggattctgaatgtacttaatttaaaagcctttgatttttacaaa
gtgattgaaagttttatcaaagcagaagccaacttgacaagagaaatgataaaacattta
gaaagatgtgaacatcgaatcatggaatcccttgcatggctctcagattcgcctttattt
gatcttattaaacaatcaaaggatcgagaaggaccagctgatcatctggaatctgcttgt
actctcaaccttcccctccagaataatcacactgcagcagatatgtatctttctcctgta
agatctccaaagaaaaaagggccagctacacgtgtaaattctactgcaaatgcagaagca
caagcaacctcagccacccagactcagaagccattgaaatctacctccctctcactcttt
tacaaaaaagtatacaggctagcctatctccgactcaataccctgtgtgcacgccttctg
tctgaccacccagaactcgaacacatcatctggacccttttccagtacacactgcaaaat
gagtatgaactcatgagagacaggcatttggaccagatcatgatgtgttccatgtatggc
atttgcaaagtaaagaatattgaccttaaattcaaaatcattgtaacagcatacaaggac
cttcctcacgctgtccaggagacgttcaaacgtgttttgatcagagaagaggaatatgat
tctattatagtattctataactcagtcttcatgcagagactgaaaacaaatattttgcag
tatgcttccacgaggccccctaccttgtcaccaatacctcacattcctcgaagcccttat
aagttttctagttctcctttacggattcctggggggaacatctatatatcacccctgaag
agtccgtataaaatttcagaaggcctgccaactccaacaaaaatgactccaagatcaaga
atcttggtgtcaattggtgaatcatttgggacttctgagaagttccagaaaataaatcag
atggtgtgtaacagtgaccgtgtgctcaaaagaagcgctgaaggaagcaaccctcctaaa
ccactgaaaaaactacgctttgatattgaaggatcagatgaagctgatggaagtagacat
ctcccaggggagtccaaatttcaacagaaactggcagaaatgacatctactcgaacacga
atgcaaaagcagaaaatgaatgacagcatggatacctcaaacaaggaggaaaagtga

DBGET integrated database retrieval system