KEGG   Trichechus manatus latirostris (Florida manatee): 101355956
Entry
101355956         CDS       T05135                                 

Definition
(RefSeq) zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101355956
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101355956
   05202 Transcriptional misregulation in cancer
    101355956
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101355956
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    101355956
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101355956
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-C2H2_6 zf-met zf-C2HC_2 Zn-ribbon_8 zf-H2C2_5 zf-Di19 zf_UBZ zinc_ribbon_15 Packaging_FI XPA_N HypA DUF3268
Other DBs
NCBI-GeneID: 101355956
NCBI-ProteinID: XP_023587923
UniProt: A0A2Y9R8K6
LinkDB
Position
Unknown
AA seq 819 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIITACHALKSVAEPAAS
PRENMEATAMEGGDKRAKEEKAAATTLSRLDQAGSSPLAGPGREPKEERGGQAESAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEATLSESSEQEMEVEPARKGEDEQEVDSAG
PASVKEEGSQLENGEDNEESAGTDSGQELSMEARSLRSGTCGDRTESKAYGSVIHKCEDC
GKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSY
RLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPT
SKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGRAGA
AWLPAPLPRPSGCAMLGLPWSHTGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRI
HTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNI
RPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGI
KILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEALKAEITKAV
KQVQEADPNTQILYACDSCGEKFLDANSLAQHVRIHTAQALVMFQADTDFYQQYGPGGTW
PAGQVLQAGELLFRPRDGAEGPPALAETPPTASECPPAE
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggatttcccccagcacagccagcatgtcctggagcagctgaaccagcagcggcagctg
gggctcttgtgcgactgcaccttcgtggtggacggggttgactttaaggcccataaagcg
gtgctggccgcctgcagcgagtacttcaagatgctctttgtggaccagaaggatgtggtg
cacctggacatcagtaacgcggcaggcctgggccaggtgctggagttcatgtacacggcc
aagctgagcctgagccctgagaacgtggacgatgtgctggctgtggccagcttcctccag
atgcaggacatcatcacggcctgccatgccctcaaatcagttgccgagcccgctgccagc
ccaagggaaaacatggaggctacagccatggaaggaggggacaagagagccaaggaggag
aaggctgctgccaccacgctgagcaggctggaccaagcgggaagcagtccattggcaggc
ccaggcagggagcccaaggaggagcgaggcggccaggctgagagcgcagccagcggggca
gagcagacggagaaggctgatgccccccgggagccaccgcctgtggagctcaagccagac
cccaccagcggcatggctgctgccgaggctgaggccaccttgtcggagagctcggagcaa
gagatggaggtggagccagcgaggaaaggggaagatgagcaagaggtggacagcgctggg
ccagcttcagtcaaggaggagggatcccagctggagaacggcgaggacaatgaggagtcg
gcgggcacagactcgggtcaggagctcagcatggaggcccggagcctgcgctctggcacc
tgtggtgaccgcactgagtccaaggcctatggctctgtcatccacaagtgtgaggactgt
gggaaggagtttacgcacacggggaacttcaagcggcacatccgcatccacacaggcgag
aagcccttctcgtgccgggagtgcagcaaggctttctctgacccggctgcctgcaaggcc
cacgagaagacacacagcccactgaaaccgtacggttgtgaggagtgcggcaagagctac
cggctcatcagcctgctgaacctgcataagaagcggcactcgggcgaggcacgctaccgc
tgcgaggactgtggcaagctctttaccacctctggcaacctcaagcggcaccagctggtg
cacagcggcgagaagccctaccagtgcgactactgcggccgctccttctctgaccccacc
tccaagatgcgccacctggagacccatgacactgacaaggagcacaagtgtccgcattgc
gacaagaagttcaaccaggtggggaatctgaaggcccacctgaagatccacatcgcggac
gggcccctcaagtgccgagagtgtgggaagcagttcaccacctcaggtagggccggggct
gcctggctgcccgcacccctccctcggccctcggggtgcgccatgctgggcctcccttgg
tctcacacaggaaacctcaagcggcaccttcggatccacagcggggagaagccctacgtg
tgcatccactgccagcggcagtttgcggaccctggcgcgctgcagcggcacgtccggatc
cacacgggcgagaagccgtgccaatgtgtgatgtgtggcaaggccttcacccaggccagc
tccctcatcgcccacgtgcgccagcacactggcgagaagccctacgtctgtgagcgctgc
ggcaagagattcgtccagtccagccagctggccaatcacattcgccaccacgacaatatc
cgcccccacaagtgcagcgtgtgcagcaaggccttcgtcaacgtgggggacctgtccaag
cacatcatcatccacactggagagaagccttacctttgtgacaagtgtggtcgtggcttc
aaccgggtggacaacctgcgttcccacgtgaagaccgtgcatcagggcaaggcaggcatc
aaaatcctggagccagaggagggtggagaggtcagcgtggtcacagttgatgacatggtc
acgctggccactgaggcactggcagcaacagccgtcactcagctcacagtggtaccagtg
ggggctgcagtgacagctgatgagacagaagcacttaaagccgagatcaccaaagctgta
aagcaagtacaggaagcagaccccaacacccagattctctacgcctgtgactcctgtggg
gagaagttcctggatgctaacagcctggcccagcacgtgcggatccacacagcccaggcc
ctggtcatgttccaggcggacacggacttctaccagcagtatggaccaggcggcacgtgg
ccggccgggcaggtgctacaggctggggagctgctgttccgccctcgggatggggctgag
ggcccgcctgctctggcagagaccccacccacagcctccgaatgtccgccggccgagtga

DBGET integrated database retrieval system