KEGG   Trichechus manatus latirostris (Florida manatee): 101356318Help
Entry
101356318         CDS       T05135                                 

Definition
(RefSeq) neutral alpha-glucosidase C isoform X4
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00052  Galactose metabolism
tmu00500  Starch and sucrose metabolism
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101356318
   00500 Starch and sucrose metabolism
    101356318
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101356318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101356318
NCBI-ProteinID: XP_004380719
UniProt: A0A2Y9DUG0
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MEAAKKEKISVDDEAVDKNIFKDCSNIAFYRRQKKQLSKKSTCRAVLDSFTTGKDSTSFQ
IINEATKIPLLAEVYGLEGNIFRLKINEESPLKPRYEVRDVLTSKLSTVRLISCSGAKGS
LVLADGKGDLKFHVTADPFKVDLVSEEDIVMSVNSLGQLYFEHLQISPKQRATKENEDDA
SVDTSQENQNDMGLWEEKFGKFVDIKANGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEVNTEPTV
EYTLTQMGSVAAKQKVRSRADVHWMSESGIIDVFLLMGPTPSDVFRQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHVKVDPDYSVYAKAKEQGFFVRNREGGDLEGVCWPGLCSYLD
FTNPKVREWYSGLFAFPVYQGSTDILFIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIRRSKGKERPFVLTRSFFAGSQKYGAVWTGDNRSDWSYLKISIP
MLLTLSVTGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMKTKRREPWLFGE
EHTQLIRDAIRERYALLPYWYSLFYRAHKTAEPIMRPLWVEFPNELETFGIEDEYMLGSA
LLVHPVTEPKAAVVDVFLPGSDEVWYDSKTFAHWEGACTVKIPVALDTIPVFQRGGSVVA
VKTTVGKSTGWMTESPYGLRVALSSQGSAVSELYLDDGHSFQYCHQNQFLNRKFLFCSGV
LINSCADERGRYPSKCVVEQILVLGLRKQPSSVTTHSSDGKDQLVAFTYSATTSTLSLEK
LSLDIGADWEVRIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagccaagaaagagaaaatcagcgttgacgatgaagctgtggacaaaaacatt
ttcaaagactgcagcaatattgctttctacaggcgtcagaaaaaacagctctccaagaag
tccacctgtcgggcagtactggactcattcacaaccggcaaagatagcaccagcttccaa
atcatcaacgaagcaactaagattcccctcctggctgaagtttatggtctagagggaaac
attttcagacttaaaatcaatgaagagtctcccctgaagcccaggtacgaagttcgcgat
gtcctcacaagcaagctgagcactgtaagattgatttcatgctcaggggctaaaggcagt
ctggtgttggcagatggaaaaggagatctgaagtttcatgtcactgcagacccattcaag
gtagacttggtgtctgaagaagacattgtgatgagcgtaaactccctgggtcaattatac
tttgagcatttacagatctctcccaaacaaagagctaccaaagaaaatgaggatgacgca
tcagttgacacctctcaggaaaatcaaaatgatatgggcctgtgggaggagaaatttgga
aaatttgtagatatcaaagctaatggtcctgcctccattggtttggatttctccttgcat
ggattcgagcatctttatgggatcccacaacatgcagaatcacaccaactgaaaaatact
ggtgatggagatgcttaccgtctttataacctggatgtctatggatataagatacatgac
aaaatgggcatttatggctcagtgccttatctcctggcccacaaactgggcagaactctg
ggcattttctggctgaatgcctcagagacactagtggaggtcaatacagagcctacagta
gagtacacactgacccagatgggctctgttgctgctaaacaaaaggtgagatctcgagct
gatgtgcactggatgtcggagagtggaatcattgatgtctttctgctgatgggacctacg
ccttctgacgtcttcaggcagtactcacacctgacagggacacaagccatgccccctctc
ttctccttgggctatcatcagtgccgctggaactatgaggatgagcaggatgtaaaagca
gtggacgcaggatttgatgaacatgacattccttacgacgtcatgtggctggacatagag
catactgagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgcaagcttgtggtcatcagtgaccctcatgtc
aaggtggatcccgactactcagtgtacgctaaggccaaagaacagggcttctttgtgcgg
aatcgtgaaggcggagacctggaaggggtatgctggcctggtctctgctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaggtcttttcgctttccctgtttaccag
ggatctactgacatcctcttcatatggaacgacatgaatgagccctctgtctttagaggg
ccagagctaaccatgcagaagaatgccatccatcatggcaattgggagcacagagaactt
cacaacatctatggtttttaccagcaaatggctactgcagaaggactgatccggcggtca
aaagggaaggagaggccctttgttcttacacgttctttctttgctgggtcacaaaagtat
ggtgctgtgtggacaggtgacaacagatcagactggagttacctgaaaatttccatcccc
atgttactcactctcagcgtcactgggatctctttctgtggagctgatgtaggcgggttc
atcggaaatccagaggcagagctgctggtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccatgaagaccaagcggcgggaaccctggctcttcggggag
gaacacacccagctgatccgagacgccatcagagagcgctacgccctcctgccctattgg
tattctctgttctaccgtgcacacaagaccgctgagcccatcatgaggcctctgtgggta
gaattccctaatgagttagagacttttggtatagaagatgaatacatgctgggaagtgct
ttattggttcatccagttacagaaccaaaagctgctgtggttgatgtgtttctgccagga
tcagatgaggtctggtatgactctaagacatttgctcattgggaaggagcatgcactgtg
aagatcccagtagccttggacactataccagtgtttcagcgaggtggaagcgtggtagca
gtaaagaccacagtaggaaaatccacaggctggatgactgagtccccctatggactccgg
gtggctctaagctctcagggttctgcagtcagtgagttgtatcttgacgatggacattcc
ttccagtactgccaccagaatcagttcttgaacaggaagtttttgttctgttcaggtgtt
ttgatcaacagttgtgcggatgagaggggtcgttatcccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaggaagcagccatcttccgtgaccacccactcatctgatggg
aaggatcagcttgtggcttttacatatagtgccacgacgtccacgctgagcctggagaag
ctgtcactggacatcggtgccgactgggaggtccgcatcaaatga

DBGET integrated database retrieval system