KEGG   Trichechus manatus latirostris (Florida manatee): 101356339Help
Entry
101356339         CDS       T05135                                 

Definition
(RefSeq) N-lysine methyltransferase SMYD2 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00310  Lysine degradation
tmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101356339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101356339
Enzymes [BR:tmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     101356339
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     101356339
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101356339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TPR_12 zf-MYND TPR_8 TPR_10 TPR_2 Complex1_LYR
Motif
Other DBs
NCBI-GeneID: 101356339
NCBI-ProteinID: XP_023597475
UniProt: A0A2Y9RR77
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MFVHAVFIKPTPTQGLNLVKVSSGKRPFWWERQVRGIWALLSGQMALNDCMIKCAASCFC
PRATTVPFLFLRKEGLSKCGRCKQAFYCNAECQPSSAVEGYLPPLPYLVHPSQHLQKRKP
TPVTLREDWLMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEF
ESHLDKLDSEKKDLIQSDIAALHHFYSKHLEFPDTESLVVLFAQVNCNGFTIEDEELSHL
GSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEISAGDEVFTSYIDLLYPTEDRNDRL
QDSYFFTCECRECTTKDKDKAKVEIRKLTDPPKAEAIRDMVRYARNVIEEFRKAKHYKSP
SELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALRYGRKIIKPYSKHY
PLYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIRHEIESH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgcatgcagtattcatcaagcccacccctactcagggactgaatctggtcaag
gtctcttctgggaagagacccttctggtgggagaggcaggtaaggggaatctgggctctg
ctctccggccagatggctcttaacgattgcatgataaaatgtgcagcttcctgcttctgt
cctcgcgccactacagtgccctttctgtttttaaggaaagaaggattgtccaaatgtgga
agatgcaagcaggcattttactgcaatgcggagtgtcagccgagcagcgctgtggaggga
tatctgccacctctcccttacttggtccacccctcacaacaccttcaaaaaaggaagcca
acacctgttactctgagagaagattggctcatgcacaagttggagtgctctcccatggtt
gtttttggggaaaactggaacccctcagagactgtcaggctaacagcaaggattctggcc
aaacagaaaatccacccagagagaactccgtcagagaagttgttagctgtgaaggagttt
gaatcacatctggataagttagacagtgagaagaaagacttgatccagagtgacattgct
gctctccatcacttttactccaagcacctagagtttcccgacactgagagcctggtagtg
ctttttgcacaggttaactgtaatggcttcacaattgaagatgaagagctttctcatttg
ggatctgcaatatttcctgatgttgcgttgatgaatcacagctgctgccccaatgtgatt
gtgacctacaaggggaccctggccgaagtgagagccgtgcaggagatcagtgcaggagat
gaggtgttcaccagctacattgacctcctgtatccaacagaagataggaatgaccggtta
caagattcctatttcttcacctgtgagtgccgggaatgtaccaccaaagacaaggataag
gccaaggtggaaatccggaagctcaccgatcccccaaaggcagaagccatccgtgacatg
gtcagatatgcccggaatgtcatcgaggaattccggaaagccaagcactacaaatcccct
agtgagctcctggagatctgcgagctcagccaggagaagatgagctcggtgttcgaagac
agtaacgtgtacatgttgcacatgatgtaccaggccatgggcgtctgcttgtacatgcag
gactgggagggagccctgcgctatggacggaagatcattaagccctacagtaagcattat
cctttgtactccctcaacgtggcctccatgtggctgaagctcggaagactgtacatgggg
ctggagaacaaggctgcgggagagaaggcgctgaagaaggccatcgccatcatggaagta
gctcacggcaaagatcacccctacatctccgagatcagacacgaaattgaaagccactga

DBGET integrated database retrieval system