KEGG   Trichechus manatus latirostris (Florida manatee): 101356579
Entry
101356579         CDS       T05135                                 

Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00220  Arginine biosynthesis
tmu00330  Arginine and proline metabolism
tmu01100  Metabolic pathways
tmu04020  Calcium signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04146  Peroxisome
tmu04371  Apelin signaling pathway
tmu04926  Relaxin signaling pathway
tmu05010  Alzheimer disease
tmu05014  Amyotrophic lateral sclerosis
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05133  Pertussis
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05200  Pathways in cancer
tmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101356579
   00330 Arginine and proline metabolism
    101356579
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101356579
   04066 HIF-1 signaling pathway
    101356579
   04020 Calcium signaling pathway
    101356579
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101356579
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101356579
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101356579
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101356579
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101356579
   05014 Amyotrophic lateral sclerosis
    101356579
   05022 Pathways of neurodegeneration - multiple diseases
    101356579
  09171 Infectious disease: bacterial
   05133 Pertussis
    101356579
   05152 Tuberculosis
    101356579
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101356579
   05145 Toxoplasmosis
    101356579
   05140 Leishmaniasis
    101356579
   05142 Chagas disease
    101356579
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101356579
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101356579
NCBI-ProteinID: XP_012413571
UniProt: A0A2Y9FZT2
LinkDB
Position
Unknown
AA seq 1161 aa
MTCPWKFLFKAKSSQYDLFEKKDINNNVGTTIYTTSSPVTQDDTKLHSLSKPGNESSPPL
TGTVQKSPESQVKLGVKLGTPPSACAGHVRIKNWGNGMTFQDTLHHQAKGDVPCKSRSCL
GSLMSPKNFTKGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVAKEIETT
GTYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCTTAKEMFEHICRHIRYATN
QGNIRSAITVFPQRSDGKHDFRVWNSQLIRYAGYQMPDGTIIGDPACVEFTQLCIDLGWK
PKYGRFDVVPLVLQADGHDPELFEIPPDLVLEVPLEHPKYAWFRELELKWYALPAVANML
LEAGGLEFPGCPFNGWYMGTEIGVRDLCDVQRYNILEEVGRRMGLETHKLASLWKDRAVI
EINIAVLHSYQKQNVTIMDHHSASESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVF
HQEMLNYILSPFYYYQVEAWKTHVWQDEKRRPRRREIQFKVLAKAMLFASVLMRKAMASR
VRVTILFATETGKSETLAQDLGALFSCAFNPKVFCMDEYRLSDLEKERLLLVVTSTFGNG
DSPGNGEKLKKSLFMLKELTNKFRYAVFGLGSSTYPQFCAFAHDIDQKLSHLGASQLTPT
GEGDELCGQEEAFRNWAVQTFKAACETFDIRGKHHIQIPKLYTSNETWDPHQYRLVQDSE
LLDLNKALGSMHAKNVFTMKLKSRQNLQSLKSSRATLLVELSYEGSQGLNYLPGEHLGVF
PGNQQALVQGILERLVDGPAPHQPVRLEVLSKNGSYWVRDKRLPPCSLSQALTYFLDITT
PPSQLLLQKLAQLATEEAERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFL
LSQLPTLKPRYYSISSSRDHTPTEVHLTVAVVTYRTRDGQGPLHHGVCSTWLSNLKPQDA
VPCFLRSASGFQLPEDPFQPCILIGPGTGIAPFRSFWQQRLHDIEHKGLQRGRMTLVFGC
RHPDEDHIYREETLEMARRGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHKEQ
GHLYVCGDVRMARDLAHTLKQLVAAKLSLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEV
KKDTVVGQPSDPRAPMTHGTS
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgacatgtccctggaagtttctgttcaaggccaaatcctcccagtatgacttgtttgag
aaaaaggacatcaacaacaacgtgggaacaaccatctatacaacctccagtcccgtaaca
caggatgacaccaagcttcacagcctcagcaagcctgggaatgagtcttccccacccctc
acggggacggtacagaagtctccagaatcccaggtcaagctgggcgtgaagctgggcaca
cccccatcggcctgcgcagggcatgtgaggatcaaaaactggggcaatgggatgactttc
caggacacacttcaccaccaggccaaaggggatgttccttgcaagtccaggtcttgcctg
gggtcccttatgagccccaaaaattttaccaaaggaccgagagacaagcctacccccccg
gacgagcttctacctcaagcaatcgaatttgtcaaccagtattacggctccttcaaagag
gcaaaaatagaggaacatctggccagggtggaagcagtagcaaaggagatcgaaacaaca
ggaacctaccagctgacaggggatgagctcatctttgccaccaaacaggcctggcgcaat
gccccccgctgcattgggaggatacagtggtccaacctacaggtctttgacgcccggagc
tgtaccactgccaaggaaatgttcgagcacatttgcagacatatacgctatgccaccaac
cagggcaatatcaggtcagccatcacggtgttcccccagcggagtgacgggaagcacgac
ttccgggtgtggaactctcagctcatccggtatgctggctaccagatgcccgatggcacc
atcataggagaccctgcctgtgtggagttcacccagctgtgcattgacctgggctggaag
ccgaagtatggccgctttgacgtggtgcctctggtcctgcaagcggatggccatgatcct
gagctctttgaaatcccaccggacctagtgcttgaggtgcccctagagcatcccaagtac
gcgtggtttcgggagctggagctgaagtggtacgccctgcctgcagtggccaacatgctg
cttgaggcgggtggccttgagtttccagggtgtcccttcaatggctggtacatgggcacg
gagatcggggtccgggacctctgcgatgtccagcgctacaacatcctggaggaagtgggc
agaaggatgggcctggaaacgcacaagctggcttccctttggaaagaccgggctgtcatt
gagatcaacatcgctgtgctccacagttaccagaaacaaaatgtgaccatcatggaccac
cactcagcttcagagtccttcatgaagtacatgcagaatgaataccggtcccgtgggggc
tgcccggccgactggatttggcttgtccccccgatttctgggagcatcacccccgtgttt
caccaggagatgttaaactatatcctgtcacctttctactattatcaggtagaggcctgg
aaaacccacgtctggcaggacgagaagcggaggcccaggagaagagagattcaattcaaa
gtcttggctaaagccatgctcttcgcctctgtgctgatgcgcaaagccatggcgtcgcga
gtcagagtcacaatcctctttgcaacagagacgggaaagtcagaaacgctggcccaggac
ctgggggccttgttcagctgcgccttcaaccccaaggttttctgcatggacgagtacagg
ctgagcgacctggagaaggagcggctgctgttggtggtgaccagcacattcgggaatggg
gactctcctggcaacggagagaaactgaagaaatcgctcttcatgttgaaagagctcact
aacaaattcaggtatgccgtgtttggccttggctccagcacataccctcagttctgcgcc
tttgcacatgacattgaccagaagctttcccacctgggggcctctcagctcaccccgaca
ggggaaggagatgagctctgcgggcaggaggaagccttccgcaactgggctgtgcaaaca
ttcaaggcagcatgtgagacatttgatatccggggcaaacaccacattcagatccccaag
ctgtacacctccaatgagacctgggacccacaccagtacaggctcgtgcaggactcagag
cttttggacctcaacaaagccctcggcagcatgcatgccaagaacgtgttcaccatgaag
ctcaaatcccggcagaacctacagagtctgaaatccagccgtgccaccctcctggtggaa
ctctcctatgagggtagccaaggcctgaactacctgcccggagagcaccttggggttttc
ccaggcaatcagcaggccctggttcaaggcatcttggagcgcctagtggatggacctgca
ccccaccaacccgtgcgcctggaggtcctcagcaagaacggcagctactgggtcagggat
aagagattgcccccctgctcactcagccaggccctcacctacttcctggacatcaccaca
cccccaagccagctactgctccaaaagctggcccagctggccacagaagaggctgagaga
cagaggctagaggccctgtgccagccctcagagtacagcaagtggaagttcaccaacagc
cctacgttcctggaagtgcttgaggagttcccatccctgcgggtatctgctggcttccta
ctctcccagctccccactctgaaaccccggtactactccatcagctcctcccgggaccat
acccccacagaagtccacctcactgttgccgtggtcacataccgcacccgagatggccag
ggtcccctgcaccatggcgtctgcagcacttggctcagcaacctgaagccccaagatgca
gtgccctgctttttgcgcagtgccagtggcttccagctccctgaggaccccttccagcct
tgcatcctcatcgggcctggtacgggcattgcccccttccgcagtttctggcagcaacgg
ctccatgacatcgagcacaaagggctccagagaggccgtatgaccctggtgtttggctgc
cgccacccggatgaggaccacatctatcgggaggagacgctggagatggcccggaggggc
gtgctgcatgaagtgcacacagcctattctcgcctgcctggccagcccaaggtctacgtt
caagacatcctgcggcagcagctggctagcgaggtgctccgtgtactccacaaagagcag
ggccacctctacgtctgtggggatgtgcgcatggcccgggacttggcacacaccctgaaa
cagctggtggctgccaagctgagcctgaacgaggagcaggttgaggactatttcttccag
ctcaagagccagaagcgctatcatgaagatatctttggggctgtatttccctatgaggtg
aaaaaggacacggtggtgggccagcccagcgatcccagagctccgatgacccacgggaca
agttaa

DBGET integrated database retrieval system