KEGG   Trichechus manatus latirostris (Florida manatee): 101356789Help
Entry
101356789         CDS       T05135                                 

Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04020  Calcium signaling pathway
tmu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101356789
   04020 Calcium signaling pathway
    101356789
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101356789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tmu04040]
    101356789
Ion channels [BR:tmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101356789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101356789
NCBI-ProteinID: XP_004372941
UniProt: A0A2Y9DE62
LinkDB All DBs
Position
Unknown
AA seq 2309 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVNGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPPWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLEK
CEEERISRGGSLKGDGGDLSSALDNQRSPSSLGKREPPWLARPCHGNCDPTQQEAGGGET
VVTFEDRARHRQSQRRSRHRRVRTEGKEPSSASRSRSVSQERGLDEDVPTDGEKDREPRG
SHGAKEPAIQKKERAQDLRRTNSLMVSRGSGLAGAIDEADTPLVPPHPELEVGKDEALME
QEPEGSSEQALLGHVQLDVGRPISQSEPDLSCITANTDKATESTSVTVAIPDMGPLVDST
VVHISNKTDGEASPLKEAEIKEDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTNPIRR
ACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIK
MIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLR
PLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKD
TEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDV
TEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNER
ACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPC
TYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKL
VNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAII
GMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTA
PSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEF
VRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVH
FTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLT
VGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQE
TVAGLSGRSGYPSMSPLSPQEIFQLACMDPTDDGQFQEQRSLEPEVSELKSVQSSNHGIY
LPSDTQEHAGSGRAASMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSE
NTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEE
RGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRQSRRQLPPVPP
KPRPLISYTSLMRHTGSLSSPADGSEGGSPLTSKPLESNNACLIESSNSPHAKQSQQSSP
QRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYR
RRRRGGPAPGMMCGAVSDLLSDTEEDDKC
NT seq 6930 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccagggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaaccccagtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccttgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggccaccatcatt
gccaactgcattgtcctggccctggaacagcaccttcccgaggacgacaagaccccgatg
tcccgcaggctggagaagacagaaccatatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggtgctcagtggcatcctggccactgcgggaacccacttc
aacacacatgtggacctgaggaccctgagggctgtccgtgtcctgaggcccctgaagctt
gtgtcagggatccctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttttgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtggcaagttacaccgagcgtgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgcagg
gactggatcggccccaacgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtattccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtatttcatccctctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccgaagagctttcatgaaactgcggcgtcagcagcagattgagcgagagttg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacatcagccttagaagtacttcgaagggcaacgatcaagaggagccggaca
gaggctatgacccgagactccagcgatgaacactgcgttgacatctcttctgtgggcacg
cctcttgcccgagccagtatcaaaagtgcaaaggtgaatggggcctcctatttccgacac
aaggaaaggctcctgcgcatctccattcgccatatggtgaaatcccaggtgttctactgg
attgtgctgagcctcgtggctctcaacaccgcctgcgtggccattgtccatcacaaccag
ccaccgtggctcacccacctcctctactatgcagaatttttgtttctgggcctcttcctc
ttggagatgtccctgaagatgtacgggatggggcctcgtctttattttcactcttcattc
aactgctttgattttggggtcactgtgggcagtatatttgaagtggtctgggcaatcttc
agacctggtacatcttttggaatcagtgtgttgcgagctctccggcttttaagaatattt
aaaataaccaagtattgggcatccctgcggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttgcttttccttctcttcctcttcatcgttgtctttgctctcctg
ggaatgcagctgtttggaggcaggtttaactttaatgatggaactccttcggcaaatttt
gacaccttccctgcagccatcatgactgtatttcagatcctgacaggtgaggactggaat
gaggtgatgtataacggaatccgttcccagggaggggtcagctcaggcatgtggtcagcc
atctacttcattgtactcaccttgtttggaaactatacactgctaaatgtgttcttggcc
atcgctgtggacaatctggccaacgcgcaagagctgaccaaggatgagcaggaggaagaa
gaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtccgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcgcaggcgccggcaccacatgtcagtgtgggagcag
cgcaccagccagctgcggaggcacatgcagatgtccagccaggaggccctcaacaaagag
gaggccccgccaatgaaccccctcaaccccctcaaccctctcagccccctcaacccgctc
aatgcccaccccagcctctaccggagacccaggcccatcgagggcctgggcctggagaag
tgtgaggaggagcgcatcagccgtgggggatccctcaagggggacggaggtgacctgtcc
agtgcactggacaaccagaggagcccctcgtccctgggcaaacgggagccgccatggctg
gccaggccctgtcatgggaactgtgaccccacccagcaggaggcagggggaggagaaact
gtggtgaccttcgaggaccgggccaggcacaggcagagccagcggcgcagccggcaccgc
cgcgtcaggacagaaggcaaggagccctcttcagcttctcggagcaggtccgtcagccag
gagcggggtctggatgaagatgtacccaccgatggggagaaggaccgggagcccaggggc
agccatggggccaaggaaccagcaatccaaaaaaaagagagagcacaggatttaaggagg
accaacagcctaatggtatccagaggctctgggctggcaggagccattgatgaggcagac
acacctctggtcccaccccatccggagctggaagtagggaaggatgaggcactgatggag
caggagccagagggcagcagtgaacaagccctgctggggcatgtgcagctggacgtgggc
cgacccatcagccagagcgagccagacctctcctgcatcacagccaacacggacaaggcc
acggagagcaccagcgtcactgtggccatccctgacatgggccccctggtggattccacc
gtggtgcacattagtaacaagactgatggagaagccagtccactgaaggaagcagagatc
aaagaggatgaggaggaggtggagaagaagaagcaaaagaaggagaagcgtgagaccggc
aaagccatggtgccacatagctccatgttcatcttcagtaccaccaacccgatccggagg
gcctgccattacatcgtgaacctgcgctactttgagatgtgcatcctcctggtgatcgcg
gccagcagcattgccctggcggctgaggaccctgtcctgaccaactccgagcgcaacaaa
gtcctgaggtattttgactatgttttcactggcgtgttcacctttgagatggtcataaag
atgatagaccaaggtttgatcctgcaggatgggtcctacttccgagacctatggaacatc
ctggactttgtggtggtggttggagcattggtcgcctttgctttggcgaacgctttggga
acaaacaaggggcgggacatcaagaccatcaagtctctgcgagtgctccgagttctgagg
ccactgaaaaccatcaagcgcctacccaagctcaaggctgtctttgattgtgtagtgacc
tcgttgaagaatgttttcaacatactcattgtctacaagctcttcatgttcatctttgct
gtcatcgcagttcagctcttcaaaggaaagttcttttattgcacagacagttccaaggac
acagagaaggagtgcataggcaactacgtagatcatgagaaaaacaagatggaggtgaag
ggccgggaatggaaacgccatgaattccactacgacaacattatctgggccctgctgacc
ctcttcaccgtctccacaggggaaggatggcctcaggttttgcagcattctgtagatgtg
acagaggaggaccgaggcccaagtcgcagcaaccgcatggagatgtccatcttttacgtg
gtctactttgtggtcttccctttcttctttgtcaatatctttgtggccctcatcatcatc
accttccaggagcaaggggataaaatgatggaagagtgcagcctggaaaagaatgagagg
gcatgcatcgactttgccatcagtgccaaacctctcacccgctacatgccgcagaacagg
cacaccttccagtaccgcgtctggcactttgtagtgtctccatccttcgagtacaccatc
atggccatgattgccctgaacactgtcgtgctgatgatgaagtactactctgctccctgt
acctatgaactggctctcaagtacctgaatatcgccttcaccatggtattttccctggag
tgtgtcctaaagatcatcgcttttggcttcttgaactatttccgagacacctggaatatc
tttgacttcatcaccgtgattggcagtatcacagaaattatactgacagacagcaagctg
gtgaacaccagtggcttcaatatgagcttcctgaagctcttccgagccgcccgcctcata
aagcttctgcggcagggctacaccatacgtattttactttggacctttgtgcagtccttt
aaggccctcccctacgtctgtcttttgattgccatgcttttcttcatttatgctattatt
ggaatgcaggtatttggaaacataaagttagatgaggagagtcacatcaatcggcacaac
aacttccggagtttctttgggtccctcatgctgctgttcaggagcgccacaggtgaggcc
tggcaggagattatgctatcatgccttggggagaaaggctgtgagccagacaccacagca
ccatctgggcagaatgagaatgagcgctgtggcaccgatctggcctacgtttactttgtc
tccttcatcttcttctgttccttcttgatgctcaacctgtttgtggccgtcatcatggac
aactttgagtacctgacgcgagactcctccatcctgggacctcaccacttggatgagttt
gtccgtgtctgggcggagtatgacagagctgcatgtggccgcatccattacactgagatg
tatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaa
gtggcatataagagattggtcctgatgaatatgccagtggctgaggacatgacagtccac
ttcacctctacacttatggctctgatccggacagctctggacatcaaaattgcaaaaggt
ggtgcagacaggcagcagctagattcggagctacaaaaggagaccttggccatctggcct
cacctgtcccagaagatgctggatctgctcgtgcccatgcccaaagcctctgacctgact
gtgggcaaaatctatgcagcaatgatgatcatggactactacaaacagagtaaggtgaag
aagcagaggcagcagctggaagaacagaaaaatgcgcccatgttccagcgcatggagccc
tcgtctctgcctcaggagatcatcgctaatgccaaagccctaccttatctccagcaggag
actgttgcaggcctgagtggccggagtggatacccctcgatgagtccactctccccccag
gaaatattccagttggcgtgtatggaccccaccgatgatggacagttccaggaacagcga
tctctggagccagaggttagtgaattaaaaagcgtgcagtcctctaaccatggcatctac
cttccttcggacacccaggagcatgcgggatccgggagggcagcctctatgccacgcctg
actgtggatccccaggtggtgacagaccctagctccatgagacgctctttttccactatt
cgggataagcgttcaaactcctcgtggttggaggaattctccatggagcgaagcagcgag
aacacttacaagtcacgtcgccggagttaccactcctccctgcggctgtcagcccatcgc
ctgaactctgactcaggccacaagtctgacactcaccgctcagggggaagagagcgaggg
cgatcaaaagagcggaagcaccttctctctcctgatgtctcccgctgcaactcagaggag
cgaggaacccaggctgactgggagtcccctgagcgccgtcagtccaggtcgcccagtgaa
ggcaggtcacagacgcccaacagacagggcaccgggtccctgagtgaaagctccatcccc
tccatctctgacaccagcaccccaagacaaagtcggcggcagctcccaccagtccctcca
aagcctcggcccctcatctcctacacctccctgatgcgacacaccgggagtctctcttca
cctgctgatgggagcgagggcggctccccgctcacctccaagcccctcgagagcaacaat
gcttgcctgatcgagtcttccaactccccgcacgcaaagcagagccaacagtcctcccca
cagcgctacatctccgagccctacctggccctgcacgaagactcccatgcctcggactgt
ggtgaggaggagacgctcaccttcgaagctgctgtggccactagcctgggccgctccaac
accatcggctccgccccacccctgcggcacagctggcagatgcccaatgggcactatcgg
cggcgaaggcgtggggggcctgcgccaggcatgatgtgtggagccgtcagtgaccttctg
agtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system