KEGG   Trichechus manatus latirostris (Florida manatee): 101356950Help
Entry
101356950         CDS       T05135                                 

Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04610  Complement and coagulation cascades
tmu05020  Prion diseases
tmu05146  Amoebiasis
tmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101356950
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101356950
  09164 Neurodegenerative disease
   05020 Prion diseases
    101356950
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101356950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 101356950
NCBI-ProteinID: XP_004391124
UniProt: A0A2Y9EDE0
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MLAPRPTILLTLLLTLGSLGQRARRPPRPPSPISTIHPKANFDTQQFAGKWLLVAVASTC
RFLQEQSYRAEATLLNVAPQGKAMAISTFRKLDGICWQVRQLYRDTGVLGRFLLQAQGAR
GAVDVVVGETDYRGFAILYLERARRLSVKLYARSIPVDDSVLSVFEQRVQNASMTEEHIV
FFPKYGFCESADQFHLLDGRPSLPPPRELQAGAPRPEDSSLLPLSLSASLEEALGTSQAL
VWV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctagcccccaggcccacaatcctcttgaccctgctcctgaccctcggctcgctgggc
cagagggcacgcaggccccctcggccaccgtcccccatcagcaccatccaccccaaagcc
aacttcgacacccagcagtttgcaggtaagtggctcctcgtggccgtggcctccacgtgc
cgcttcctgcaggagcagagctaccgggcagaggccacattgctgaatgtggctccccag
ggcaaagccatggccatcagcaccttccgcaagctggatgggatctgctggcaggtgcgg
cagctctacagagacactggggtccttgggcggttcctgctccaagcccaaggtgcccgg
ggggctgtggacgtggtcgtcggggagacagactaccggggcttcgccatcctgtaccta
gagcgggctcggcggctctcagtgaagttgtatgcccgctcgatccctgtggatgactcg
gtcctgagcgtgtttgagcagcgggtccagaacgccagtatgacggaagagcacatcgtt
ttcttccccaagtacggtttctgcgagtctgcggaccagttccacctcctggatggccgt
ccttctcttccacccccacgcgagctgcaggcaggagcccctcggccagaggacagctcg
ctcctaccactgtccctttcagcctccctcgaggaggcgctgggcaccagccaggccctg
gtgtgggtgtga

DBGET integrated database retrieval system