KEGG   Trichechus manatus latirostris (Florida manatee): 101357079
Entry
101357079         CDS       T05135                                 

Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04530  Tight junction
tmu04659  Th17 cell differentiation
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101357079
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101357079
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357079
   05202 Transcriptional misregulation in cancer
    101357079
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101357079
   05220 Chronic myeloid leukemia
    101357079
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101357079
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    101357079
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 101357079
NCBI-ProteinID: XP_023597100
UniProt: A0A2Y9RU08
LinkDB
Position
Unknown
AA seq 466 aa
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRS
GDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM
AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KITVDGPREPRRHRQKLDDQAKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNRASVN
HAAAFNPQPQSQIQDSRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLS
AELSSRLTTAPDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMPAMGSA
TRYHTYLPPPYPGSSQAQGGPFQAGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTN
ASTGSALLNPSLPNQNDGVEAEGSHSNSPTNMAPTARLEEAVWRPY
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcgtacccacagtgcttcatgagagat
gccagcacgagccgccgcttcacgccgccttccaccgcgctgagcccgggcaagatgagc
gaggcgctgccgctgggcgccccggacgccggcgccgccctggccggcaagctgaggagc
ggcgaccgcagcatggtggaggtgctggccgaccacccgggcgagctggtgcgcaccgac
agccccaacttcctctgctccgtactgccgacgcactggcgctgcaacaagaccctgccc
atcgccttcaaggtggtggctctgggggacgtcccagatggcactctggtcactgtgatg
gctggcaatgatgaaaactactcggctgagctgagaaatgccaccgcagccatgaagaac
caagtcgcaagattcaacgacctcaggtttgtcgggcgcagcggaagagggaagagcttc
accctgaccatcactgtcttcacaaaccctccacaagtcgccacctaccacagagccatc
aaaatcaccgtggatggacccagggaacctcgaagacaccggcagaagctagatgaccag
gccaagcccgggagcttgtccttctccgagcggctcagtgagctggagcagctgcggcgg
acagccatgagggttagcccacaccacccagcccccacacccaaccgcgcctccgtgaac
cacgccgctgcctttaaccctcagcctcagagtcagatacaggactctaggcagatccag
ccgtccccaccgtggtcctatgatcagtcctaccagtacctgggatcgatcgcctctcct
tccgtgcacccagcaacacccatctcgcctggacgggccagtggcatgacaaccctctct
gccgagctttccagccggctcacaaccgcaccggatctgacggccttcggcgaccctcgc
cagttccccgcgctgccctccatctcggacccgcgcatgcactaccccggcgccttcact
tactcgcccacgcccgtcacgtcgggcatcggcatcggcatgccagccatgggctcggcc
acgcgctaccacacgtacctgccgccaccctaccccggctcgtcacaggcgcagggcggc
ccgttccaggccggctcgccgtcctaccacctgtactacggcgcttcagccggctcctac
cagttctccatggtgggtggcgagcgctccccgccgcgcatcctgccgccctgcaccaac
gcttctacgggctcggccctgctcaaccccagcctcccgaaccagaacgacggggtggag
gccgagggcagccacagcaactcgcccaccaacatggcgcccaccgcgcgcctcgaagag
gccgtgtggcggccatattga

DBGET integrated database retrieval system