KEGG   Trichechus manatus latirostris (Florida manatee): 101357179Help
Entry
101357179         CDS       T05135                                 

Definition
(RefSeq) sialidase-2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00511  Other glycan degradation
tmu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101357179
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101357179
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101357179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-GeneID: 101357179
NCBI-ProteinID: XP_004389565
LinkDB All DBs
Position
Unknown
AA seq 376 aa AA seqDB search
MASRPVLQRESVFQTGDYVYRIPALLYLPQQNTLLAFAERRVGKADEHAELIVLRRGGYN
STTHQVQWQDQEVVAQAQLAGHRSMNPCPLYDEKTGTLFLFFIAISGQVSEQHQLQTRVN
VTRLCQVTSTDHGKTWSPPRDLTNTAIGSAHREWATFAVGPGHCLQLHNKTRSLVLPAYA
YRNLHPLQVPPPFAFCFLSHDHGHTWERGHFVAQETLECQVAELGVGEQSVVYLNARSFR
RTRVQAESTNDGLKFKKPQPVKKLVEPPNGCHGSIISFSSPHAESASSDKWLLYIHPADP
KQRSNLGVYLNKWPLDPEAWSEPSLLAVGSCAYSDLQSMGAGPDGSPQFGCLYESDNYGK
IVFVLFTLKQAFPAEI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgccctgtgctgcagagggagagtgtgttccagacaggtgactatgtctac
agaatccctgctctgctctacctgccccagcagaataccctgctggcctttgcggagagg
cgggtgggcaaggcggatgagcatgcagagctgatcgtcctgcgcagagggggctacaac
tcgaccacccaccaggtccagtggcaagaccaggaggtggttgcccaagcccagctggca
ggtcaccggtccatgaacccatgccccttgtacgatgagaagactggaacccttttcctc
ttcttcattgccatttcagggcaggtttctgagcaacaccagctccaaacaagggtcaac
gtgacccggttgtgccaagtcaccagcacagaccacgggaagacctggagcccgcccaga
gacctcaccaacactgccattggctcggcccacagggaatgggccacctttgccgtgggc
ccgggccactgtctgcagctgcataacaagaccagaagcctggtgctgcctgcctatgct
taccggaaccttcaccccctccaggtgcctcccccctttgccttctgcttcctcagtcat
gaccacggacacacttgggaacgagggcactttgtggcccaggaaaccctggagtgccaa
gtggctgaacttggggttggggagcagagtgtggtgtatctcaatgccagaagcttcagg
agaaccagggtccaggccgagagcaccaacgacgggctcaaatttaagaagccccaacca
gtgaagaagctagtggaacctcctaatggctgccacgggagcatcatcagcttctccagc
ccccacgcagagtcagcctcctcggacaagtggctgctctacattcacccagcagaccca
aagcagaggtctaacctgggggtgtacctcaacaagtggccgctggatcccgaggcctgg
tccgagccttctctgctggctgtgggcagctgtgcctattctgacctccagagcatggga
gctgggcccgatgggtccccccagtttgggtgtctgtacgagtctgataattacgggaag
atcgtcttcgtgctattcactctgaagcaagccttcccagctgagatctga

DBGET integrated database retrieval system