KEGG   Trichechus manatus latirostris (Florida manatee): 101357486
Entry
101357486         CDS       T05135                                 

Definition
(RefSeq) mast/stem cell growth factor receptor Kit
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04640  Hematopoietic cell lineage
tmu04916  Melanogenesis
tmu05200  Pathways in cancer
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101357486
   04014 Ras signaling pathway
    101357486
   04015 Rap1 signaling pathway
    101357486
   04072 Phospholipase D signaling pathway
    101357486
   04151 PI3K-Akt signaling pathway
    101357486
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101357486
  09152 Endocrine system
   04916 Melanogenesis
    101357486
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357486
   05230 Central carbon metabolism in cancer
    101357486
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101357486
   05224 Breast cancer
    101357486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101357486
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tmu04090]
    101357486
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101357486
Protein kinases [BR:tmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101357486
CD molecules [BR:tmu04090]
 Proteins
  101357486
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 V-set Ig_4 Pkinase_fungal APH C1-set
Other DBs
NCBI-GeneID: 101357486
NCBI-ProteinID: XP_023593105
UniProt: A0A2Y9RCN9
LinkDB
Position
Unknown
AA seq 989 aa
MHLGESRNVEQSSGPSAATAMRGACGARDFLYVLLLLLGVQTGSSQPSVSPENLSPPSIH
PAKPQLIVSVGDEIRLLCTDPGFVKWTFEMLGQVNENKHNEWVMEKAVTTNTGNYTCTNE
GGLSSSIYVFVRDPNKLFLVNQLLYGKEGNDALVRCPLTDPEVSNYSLKGCKGKPLPKDL
VFVPDPKTGITIRSVKRAYHQLCVHCSADQGGKSVLSEKFILKVRAAIKAVPSVSVSKAS
YLLREGEEFAVTCTIKDETSSVLSMWIRENSQHIKAEVQSTSRHKGDFYYERQEMLTISS
ARVNDSGVFICYANNTFGSANVTTTLKVVDKGFIHISPIMNTTIFVNDGENLDLIVEYEA
YPKPEHQQWIYMNRTSTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGIYTFLVSNSDA
NSSVTFNVYVNTKPEILTSDRLANGKLQCVAAGFPEPTIEWYFCPGTEQRCSASIVPGDV
QIQNSSVSPFGRLVVQSSIDSSAFKHNGTFECKAYNDVGKNSAYFNFAFKEQIQSHTLFT
PLLIGFVIAAGMMCIVVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWE
FPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLMEREALMSELKV
LSYLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFICAKQEDHAEAAVY
KNLLHSKESSTCDSTNEYMDMKPGVSYVVPTKADKRRSERIGSYIEQDVTPAIMEDDELA
LDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNY
VVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMI
KEGFRMFSPQHAPAEMYDIMKTCWDADPLKRPTFKQMVQLIEKQISDSTNHIYSNFANPS
PIPADHSVRINSVGSSASSTQPLLVHEDV
NT seq 2970 nt   +upstreamnt  +downstreamnt
atgcacttgggcgagagcaggaacgtggaacagagctcgggtcccagcgcagccaccgcg
atgagaggcgcttgcggcgccagggattttctctacgtcctgcttctcctgcttggcgtc
cagacaggctcttcccaaccatctgtgagtccagaaaatctgtctccaccatccatccat
ccagcaaaaccacagttaatagtcagtgtgggcgacgagattaggctgctatgcacagat
ccaggctttgtcaagtggacttttgagatgctgggtcaagtgaatgagaataaacacaat
gaatgggtcatggagaaagcagtcaccaccaacacaggcaactacacgtgcaccaatgaa
ggcggcttaagcagttccatttatgtatttgttagagatcctaacaagcttttcctggtg
aaccagctgctgtatgggaaagaaggcaacgatgcgttggtccgctgtcctctgacggat
ccggaggtgtccaattactcccttaagggttgcaagggaaaacctcttcccaaggacttg
gtgtttgtccctgatcccaagactggtatcactatcagaagcgtgaagcgtgcctatcat
cagctttgtgtgcactgctctgcagaccaggggggcaagtcggtgctgtcagagaagttc
atcctgaaagtgagggcagccatcaaagctgtaccgagtgtctctgtatccaaagcaagc
tatcttcttagggagggggaagaatttgccgtgacatgtacaataaaagatgagactagt
tctgtgctatcaatgtggataagggaaaacagtcagcacattaaagcagaggtacaaagt
acaagccggcataagggtgatttctattatgaacgtcaggaaatgttgactatcagctca
gcaagagttaatgattctggagtgttcatatgttatgccaataatacttttggatcagca
aatgtcacaacaaccttgaaagtagtagataaaggattcattcatatctctcccataatg
aatactacaatatttgtaaatgatggagaaaatttagatttaattgttgaatacgaggca
taccccaaacctgaacaccagcagtggatatatatgaatagaacctccactgataaatgg
gaggattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatcta
accaggttaaaagggaccgaaggaggcatttacacatttcttgtgtccaattctgatgcc
aactcttccgtaacatttaatgtttacgtgaacacaaaaccagaaattctgacttctgac
aggctcgcgaatggcaagctccagtgtgtggcagcaggattcccagagcccacaatagag
tggtatttttgtccaggaacggagcagagatgttccgcttctattgtgccaggggatgtg
cagatacaaaactcatctgtgtcgccgtttggaagactagtggttcaaagttccatagat
tccagtgcattcaagcacaatggcacgtttgagtgtaaggcttacaacgatgtgggcaag
aattctgcctattttaactttgcatttaaagaacaaatccagtcccacaccctgttcaca
cctttgctgattggttttgtgatcgcagctgggatgatgtgcatcgttgtgatgattctt
acctacaaatatttacagaaacccatgtatgaagtgcagtggaaggttgtcgaggagata
aatggaaacaattatgtgtacatagacccaactcaacttccttatgatcacaaatgggag
tttcccagaaacaggctgagttttgggaaaaccttgggtgccggagcttttgggaaagtt
gttgaggctactgcatacggcttaattaaatcggatgcagcgatgaccgtggctgtgaag
atgctcaaaccaagtgcccacttaatggaacgagaagccctaatgtctgaactcaaagtc
ctgagttacctcggtaatcatatgaacattgtgaatcttcttggagcatgcactgtcgga
gggcccaccctggtcattacagaatattgttgctatggtgatcttctgaattttttgaga
cgaaaacgtgattcatttatttgtgccaagcaggaagatcatgcagaagcagcagtttat
aagaaccttctgcattcaaaggagtcttcgacgtgtgatagtactaatgagtacatggac
atgaaacctggagtttcttatgttgtcccaaccaaagcagacaaaaggagatctgagaga
ataggctcatacatagaacaggatgtgactcccgccatcatggaggatgacgagttggct
ctggaccttgaagacttgctaagcttttcctaccaagtggcaaagggcatggccttcctt
gcttcgaagaattgcattcatagagacttggcagccaggaatatcctccttactcatggt
cgaattacaaaaatttgtgactttggtctagccagagacatcaagaatgactctaattat
gtagtcaaaggaaacgctcgactacctgtgaagtggatggcccctgaaagcattttcaac
tgtgtgtacacatttgaaagtgatgtctggtcctatgggattttcctgtgggagctgttc
tccttaggaagcagcccctaccctggaatgccagtcgattctaagttctacaagatgatc
aaggaaggtttccggatgttcagccctcagcatgcacctgctgaaatgtatgacatcatg
aagacttgctgggatgctgatcccctaaagaggccaaccttcaagcagatggttcagctc
attgagaagcagatttcagatagcaccaatcatatttactccaattttgcaaaccccagc
cccatcccagcggatcattcagtgcgaatcaactccgtcggcagcagtgcttcttccacc
cagcctctgcttgtgcacgaagacgtctga

DBGET integrated database retrieval system