KEGG   Trichechus manatus latirostris (Florida manatee): 101357920
Entry
101357920         CDS       T05135                                 

Definition
(RefSeq) integrin alpha-M isoform X2
  KO
K06461  integrin alpha M
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04015  Rap1 signaling pathway
tmu04145  Phagosome
tmu04514  Cell adhesion molecules
tmu04610  Complement and coagulation cascades
tmu04613  Neutrophil extracellular trap formation
tmu04640  Hematopoietic cell lineage
tmu04670  Leukocyte transendothelial migration
tmu04810  Regulation of actin cytoskeleton
tmu05133  Pertussis
tmu05134  Legionellosis
tmu05140  Leishmaniasis
tmu05146  Amoebiasis
tmu05150  Staphylococcus aureus infection
tmu05152  Tuberculosis
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101357920
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101357920
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101357920
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101357920
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101357920
   04610 Complement and coagulation cascades
    101357920
   04613  Neutrophil extracellular trap formation
    101357920
   04670 Leukocyte transendothelial migration
    101357920
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101357920
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101357920
  09171 Infectious disease: bacterial
   05133 Pertussis
    101357920
   05134 Legionellosis
    101357920
   05150 Staphylococcus aureus infection
    101357920
   05152 Tuberculosis
    101357920
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101357920
   05140 Leishmaniasis
    101357920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101357920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101357920
   04515 Cell adhesion molecules [BR:tmu04515]
    101357920
   04090 CD molecules [BR:tmu04090]
    101357920
   00536 Glycosaminoglycan binding proteins [BR:tmu00536]
    101357920
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101357920
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101357920
Cell adhesion molecules [BR:tmu04515]
 Integrins
  Integrin alpha subunits
   101357920
CD molecules [BR:tmu04090]
 Proteins
  101357920
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101357920
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2 Senescence TMEM18
Other DBs
NCBI-GeneID: 101357920
NCBI-ProteinID: XP_012413925
UniProt: A0A2Y9G3W7
LinkDB
Position
Unknown
AA seq 1152 aa
MTSKFFLLTALALCHGFNLDVENAMTFQENARGFGHSVVQFEGSRVVVGAPQEIKAPNKT
GILYQCDYSMGKCEPIPLEVPLQAVNMSLGLSLAATTTPSRLLACGPTVHLICKENIYLN
GFCFMFGSNLLQQPQTFPETLAGCPRLETDIAFLIDGSGSISPNEFEQMKKFVSTVMDQF
KTFKTLFSLMQYSEKFWTHFTFKDFEKNPNPRSLVTPIRQLSGRTHTATGIRKAVRELFH
SSNGAREDARKILVVITDGEKYGDPLGYEDVIPEADREGVVRYVIGVGDAFSSEKNREEL
RTIASKPSSEHVFQVNNFEALKTIQNQLKEKIFAIEGTQTGSTSSFEYEMSQEGFSAAIT
SNGPLLGAVGSFDWAGGAFLRTSKDKATFISTTRVDSDMNDAYLGYAAEVILRNWVQSLL
LGAPRYQHTGMVVMFKQDAGTWKTNGVVKGSQIGSYFGASLCSVDMDIDGNTDLILIGAP
HYYEQSRGGQVSICPLPRGRAKWQCKAVLLGEQGHTWGRFGAALTVLGDVNGDKLTDVAI
GAPGEQENRGAVYIFLGASGLGVNPSHSQRIAGSQLSPRLQYFGQSLSGGQDITLDGLVD
LAVGAQGHMLLFRSQPVLRVEVTMEFTPREVARKVFECHGPVARNQNAGEVRICFRVRKI
TRDRLTVGEIQSIITYDLALDAGRPNPRAVFDETKNSTYRQTQTLALMENCDTLKLQLPD
CVEDPVTPIVLRLNFSLEGRPSPSFGNLRPVLAMDAQRLFTALFPFEKNCGNDGICQDDL
SVTFSFMNLDTLVVGGSRDLNVTLTVRNQGEDSYRTQVAFFYPPGLSYRRVSGAQNQRSQ
RFWRLSCESGPSHEGPGTLKSVSCNINHPIFPGNSEVTFNTTFDVDSDASFGNKLLLKAN
VTSENNMPKTKKSEFQLELPVKYAVHTVVTSLEHSTKYLNFTASESTSRVVEHQYQFSNL
GDRSVSISVVFWVPVLLNQVKVLKELQVDFSQNIYNSSYTEERFPPHTDFLAEIKKTSVV
NCSIAVCKRIQYDIPSFSIQEEFTVTLKGNLSFDWYIKTSNNYLLVVSTAEILFNNSVFT
LLPGQEAFVRAQTQTKVEQYEIHNPVPLIVGSSVGGLLLLALITVGLYKLGFFKRQYKDM
MSEAAPQAAPPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgactagcaaattctttctgttgacagccctggccttatgtcatgggttcaacctggac
gtggaaaatgcaatgaccttccaagagaatgcaaggggttttggacacagtgtggtccag
tttgagggatcaagggtggtggttggagccccccaggagataaaggctcccaacaaaact
ggcatcctctaccagtgtgactacagcatgggcaagtgtgagcccatccccctggaggtc
cccttgcaggctgtgaatatgtccttgggcctgtctctggcagccactactaccccctcc
cgtctgttggcctgcggccccactgtgcacctaatctgcaaggagaacatctatctgaat
ggcttctgcttcatgtttggatctaacctacttcagcagccccagacgtttcctgagacc
cttgctggatgtcctcgactggagactgacattgccttcttgattgatggttctggtagc
atcagcccaaatgagtttgagcaaatgaagaagtttgtctcaactgtgatggaccaattc
aaaacgttcaaaaccttgttctctttgatgcagtactccgaaaagttctggacccatttc
accttcaaggatttcgagaaaaatcccaacccaagatcgctggtgacaccaataagacaa
ctgtcggggaggacacacactgccacaggaatccgcaaagcagtaagggaactgtttcac
agcagcaacggggcccgggaggatgcccgtaagatcctagttgtcatcacagatggagaa
aagtatggtgatcccttgggctacgaggatgtcattcccgaagcggacagagaaggggtc
gtccgctatgtcattggggtgggagatgccttcagtagtgagaaaaaccgtgaagagctt
agaaccatcgcatccaagccatcttctgaacacgtgttccaggtgaataactttgaagct
ctgaagactattcaaaaccagctgaaagaaaagatctttgcaattgagggtactcagaca
ggaagcaccagctcatttgagtatgagatgtctcaggaaggcttcagtgctgccatcact
tctaatggtcccttgctgggtgccgtggggagctttgactgggctggtggagcttttttg
agaacttcaaaggataaagccaccttcatcagcacaaccagggtggattcagacatgaat
gatgcttacttgggttatgctgccgaagtcatcctgagaaattgggtacagagtctgctt
ctgggggcacctcgatatcaacatactggtatggtggtgatgttcaaacaggatgctgga
acctggaagaccaatggtgttgtcaaggggagccagatcggctcctactttggggcctcc
ctctgctccgtggacatggacatagatggcaacaccgacctgatcctcatcggggccccc
cattactatgagcagagccgggggggccaggtgtctatctgccccttgccccgggggcgg
gccaagtggcagtgtaaggctgttctcttgggggagcagggccatacttggggccgcttt
ggtgcagccctgacagtgctgggggacgtaaatggggacaagttgacagacgtggccatt
ggagcaccaggggagcaggagaaccgaggtgccgtctacatatttcttggagcatcaggg
ctgggcgtcaacccctcccacagccagcggattgcaggctcccagctgtctcccaggctc
caatattttggtcagtcactgagtggtggccaggatatcacactggatggtctggtggac
ctggctgtaggagcccaggggcatatgctgctgttcaggtcccagccggtattaagagtc
gaggtgaccatggagttcacacccagagaagtggcaaggaaggtatttgagtgtcacgga
ccggtggcgagaaaccagaatgctggggaggtcagaatctgcttccgtgtccgcaaaatc
acacgggaccgactgacagtaggagagatccaaagcattatcacttatgacctggctctg
gatgctggccgcccaaatccccgtgccgtctttgatgagacaaagaactctacatataga
caaacacagaccttggcattgatggagaattgtgacaccctgaagctacagttaccggat
tgtgtagaggacccagtgactcccattgtcctgcgcctcaacttctctctggaggggcgg
ccctcaccctctttcgggaatctccggccagtgctggctatggatgctcagagactcttc
acagccttgttcccctttgagaaaaattgtggcaatgatggtatctgccaggatgacctc
agcgtcaccttcagttttatgaacctggacacactggtggtgggtggttcccgggacctc
aatgtgactctgactgtgagaaaccagggcgaggactcctacaggactcaggttgccttc
ttctacccacctggcttgtcttatcggagagtgtcaggggcccagaaccagcgctcacag
agattctggcgcctgtcctgtgagtctgggccctcccatgaagggcctgggaccctgaag
agcgtcagctgcaacataaaccaccccatcttcccaggcaactccgaggtcacctttaat
accactttcgatgtggactctgatgcttcttttggaaacaaattactcctcaaagccaat
gtgaccagtgagaacaacatgcccaagaccaaaaaatctgaattccagctggaactgcct
gtgaaatatgctgtccacacagtggtcaccagccttgagcactctaccaaatatctcaac
ttcacagcctcagagagcaccagccgggttgtggagcatcaatatcagttcagtaacctg
ggggacaggagcgtatccatcagtgtggtcttctgggtccccgttctgctgaaccaggtg
aaggtgttgaaagaactccaggttgacttctcccagaacatctacaattcatcctacact
gaagaaagatttcctcctcacactgacttcctggctgagattaagaagacctcagttgtg
aactgctctattgcagtctgcaagagaatacagtatgacatcccttccttcagcatccag
gaagaattcaccgtcaccctcaaaggcaacctctcatttgactggtatatcaagacttcg
aataactacctcctggttgtgagcacagctgagatcttgtttaacaattcggtgtttacc
ctgcttccaggacaggaggcatttgtgagggcccagacacagaccaaagtggagcagtat
gaaattcacaaccctgtaccgcttattgtgggcagttccgtggggggactgttgcttctg
gccctcatcaccgtgggactgtacaagcttggcttcttcaaacggcagtacaaggacatg
atgagtgaagctgctcctcaagcggccccaccccagtaa

DBGET integrated database retrieval system