KEGG   Trichechus manatus latirostris (Florida manatee): 101357995
Entry
101357995         CDS       T05135                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04630  JAK-STAT signaling pathway
tmu04640  Hematopoietic cell lineage
tmu04650  Natural killer cell mediated cytotoxicity
tmu04657  IL-17 signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04668  TNF signaling pathway
tmu05146  Amoebiasis
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05171  Coronavirus disease - COVID-19
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
tmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101357995
   04668 TNF signaling pathway
    101357995
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101357995
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101357995
   04650 Natural killer cell mediated cytotoxicity
    101357995
   04660 T cell receptor signaling pathway
    101357995
   04657 IL-17 signaling pathway
    101357995
   04664 Fc epsilon RI signaling pathway
    101357995
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101357995
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101357995
  09163 Immune disease
   05323 Rheumatoid arthritis
    101357995
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101357995
   05171 Coronavirus disease - COVID-19
    101357995
   05167 Kaposi sarcoma-associated herpesvirus infection
    101357995
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101357995
Messenger RNA biogenesis [BR:tmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     101357995
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  CSF and other factors
   101357995
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Heparin
  Cytokines
   101357995
SSDB
Motif
Pfam: GM_CSF N1221
Other DBs
NCBI-GeneID: 101357995
NCBI-ProteinID: XP_023594797
UniProt: A0A2Y9RK19
LinkDB
Position
Unknown
AA seq 137 aa
MWLQNLLLLATVACSISAPTENPVTRPSMHVDAIQEALHLLRNSNGTATVTKAVHVVSGK
FDPQKPTCLQTRLDLYKQGLQGSLTRLEGPLNIMAEHYQKHCPHTLETACQRQTITFEIF
KQNLEEFLLNVPFDCWQ
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcttggccactgtggcctgcagcatctccgcacccaca
gaaaaccctgtcacccggccctcaatgcacgtcgatgccatccaggaggccctacacctc
ctgaggaacagtaatggcactgctactgtgacaaaagcagtacatgtcgtctcaggaaag
tttgacccccagaagccaacatgcctgcagacccgtctggacctgtacaagcagggcctt
cagggcagcctcaccaggctcgagggccccctgaacataatggccgaacactatcagaag
cactgtccccataccctggaaactgcttgtcaacgccagactatcaccttcgaaatcttc
aaacaaaacctggaggaatttctgctcaatgttccctttgactgctggcagtag

DBGET integrated database retrieval system