KEGG   Trichechus manatus latirostris (Florida manatee): 101358349Help
Entry
101358349         CDS       T05135                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04146  Peroxisome
tmu04213  Longevity regulating pathway - multiple species
tmu05014  Amyotrophic lateral sclerosis (ALS)
tmu05016  Huntington disease
tmu05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101358349
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101358349
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101358349
   05016 Huntington disease
    101358349
   05020 Prion diseases
    101358349
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101358349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101358349
NCBI-ProteinID: XP_004387041
UniProt: A0A2Y9E5Y5
LinkDB All DBs
Position
Unknown
AA seq 157 aa AA seqDB search
MTTKAVCVLKGDGPVAGTIYFEQKGDGSVMVTGRITGLTEGHHGFHVHQFGDNTQGCTSA
GPHFNPFSKKHGGPQSAERHVGDLGNVTANKDGVAHVSIEDPLISLTGSNSIIGRTMVVH
EKEDDLGQGGNEESTKTGNAGGRLACGVIGIASENIP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaaggctgtgtgcgtgctgaagggcgacggcccggtggcgggcaccatctac
ttcgagcagaagggagacgggtctgtcatggtaacaggacgcatcacaggattgacggaa
ggccaccacggtttccacgttcaccagtttggcgataacacacaaggctgtaccagtgcc
gggcctcactttaatcctttttccaaaaaacatggtgggccacagtctgcagagaggcat
gttggagacctgggcaacgtgactgccaacaaagatggcgtggcccatgtgtctattgaa
gaccctctgatctcgctcacaggaagcaattccatcattggccgcacaatggtggtccat
gaaaaagaggatgacttgggccaaggtggaaatgaagaaagtacaaagacgggaaatgct
ggaggtcgtttggcttgtggggtaattgggatcgcctcagaaaacattccttaa

DBGET integrated database retrieval system