KEGG   Trichechus manatus latirostris (Florida manatee): 101358528Help
Entry
101358528         CDS       T05135                                 

Definition
(RefSeq) hexokinase-1 isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00010  Glycolysis / Gluconeogenesis
tmu00051  Fructose and mannose metabolism
tmu00052  Galactose metabolism
tmu00500  Starch and sucrose metabolism
tmu00520  Amino sugar and nucleotide sugar metabolism
tmu00524  Neomycin, kanamycin and gentamicin biosynthesis
tmu01100  Metabolic pathways
tmu01200  Carbon metabolism
tmu04066  HIF-1 signaling pathway
tmu04910  Insulin signaling pathway
tmu04930  Type II diabetes mellitus
tmu04973  Carbohydrate digestion and absorption
tmu05230  Central carbon metabolism in cancer
Module
tmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101358528
   00051 Fructose and mannose metabolism
    101358528
   00052 Galactose metabolism
    101358528
   00500 Starch and sucrose metabolism
    101358528
   00520 Amino sugar and nucleotide sugar metabolism
    101358528
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101358528
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101358528
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101358528
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101358528
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    101358528
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101358528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101358528
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101358528
Membrane trafficking [BR:tmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101358528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 101358528
NCBI-ProteinID: XP_004386438
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQIKKIDKYLYTMRLSDETLLDIMARFREEMKSGLSRDSNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVDHEQHQNVRMESEVYDTPENIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGV
EGADVVKLLDKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRYIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YIGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEMNKEGLHNAKEILTRLG
VEPSHDDCISVQHVCAIVSFRSANLVAATLGAILCRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIQETLAHFRLT
KEMLMEVKKRMRDEMELGLKKATHEKATVKMLPSFVRSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYTIPIEVMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQKSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVETVEGNDGQMCINMEWGAFGDNGCLDD
IRTGYDKLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRRLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPQCNVSFLLSEDGSGKG
AALITAVGVRLRGEVPPSS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaaatcaaa
aagattgacaagtatctttataccatgcggctctccgatgaaactctgttggatatcatg
gctcgtttcagggaggagatgaagagtggcctatcccgggattctaatccaacagccaca
gtcaagatgttgcccacatttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccttggatcttggtgggtcttcctttcgaattctacgggtacaagtggatcacgag
cagcatcagaatgttcgcatggagtctgaggtgtacgacacccctgagaacatcatgcac
ggcagtggaagccagcttttcgatcacgtcgctgagtgcttgggagacttcatggagaag
aagaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccctgccgacaa
tccaaaattgatgaggccgtcctgatcacctggacaaagagatttaaagcaagtggagta
gagggagcagacgtggtgaagctgcttgacaaagccatcaagaaacgaggggactacgac
gccaacattgtggctgtggtgaatgacacagtggggaccatgatgacctgtggctatgac
gaccagcattgtgaagtcggcctgatcattggcactggcacaaatgcttgctacatggag
gaactgaggtacattgacctggtggaaggcgacgaggggaggatgtgcatcaacacggag
tggggggcctttggggatgacgggtccctagaagacatccggactgagtttgatcgagag
atagaccggggctccctcaacccgggaaagcaactgtttgagaagatggtcagtggcatg
tacataggggagctggttcgactgatcctggtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgcttaccagaggaaagttcaacaccagtgatgtgtca
gccattgaaatgaataaggaaggcctccacaatgccaaagaaatcctgactcgtctggga
gtggaaccatctcacgatgactgtatttcagtccagcacgtgtgcgccattgtctcattc
cgctcggccaacctggtggctgcaacgctgggtgccatcttgtgccgccttcgtgataat
aagggcacgcccaggctgcggacaacggttggtgtcgacggatctctttacaagacgcac
ccacagtattcccgacgcttccacaagactctgaggcgcttggtgcctgactctgatgtg
cgtttcctgctgtcggagagcggcagtggcaagggggctgccatggtgactgcggtggct
taccgcctggccgagcagcaccggcagatccaggagaccctggcccacttccgcctcacc
aaggaaatgctgatggaggtgaagaagcggatgcgggacgagatggagttagggctgaag
aaggcgacgcatgagaaggccactgtcaagatgctgccctcctttgtccggagcactccg
gatgggtctgagaatggtgacttcttggccctcgatcttggaggaacgaatttccgtgtc
ctgctggtgaaaatccgtagtgggaaaaggagaacagtggaaatgcacaacaagatctat
accattcccatcgaggtcatgcagggcactggggaagagctgtttgaccatatcgtttcc
tgcatctccgacttcctggactacatggggatcaaaggccccagaatgcctctgggcttc
acgttctcctttccctgcaagcagaaaagcttggatgcgggtatcttgatcacctggaca
aagggttttaaggcaactgactgtgtggggcacgatgtagccaccttactaagggatgca
ataaaaaggagagaggaatttgacctggatgtggtggctgtggtcaacgacacggtgggc
accatgatgacctgtgcttatgaggagcccagctgtgagattggactcatcgtaggaacg
ggcagcaatgcctgctacatggaagagatgaagaacgttgagacggtggaagggaatgat
gggcagatgtgtatcaacatggaatggggtgcctttggagacaacgggtgtctggatgat
atcagaacaggctatgataaattggtggatgaatattctctaaatgctgggaaacaaagg
tatgagaagatgattagcggcatgtacctgggggagattgttcgcaacatcttgattgac
ttcaccaagaagggatttctcttccgggggcagatctctgagaccttgaagacgcggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtt
cgggccatcctccaacagctgggactgaacagcacctgtgatgacagtatcctcgtgaag
actgtgtgtggggtggtgtccaggagggccgcgcagctgtgtggcgcgggcatggcggcc
gtggtggataagatccgtgagaacaggagactggaccatctgaatgtgactgtgggagtg
gacgggacgctgtacaaacttcacccccacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccacaatgtaacgtgtccttcctgctgtcagaagatggtagtggcaaaggg
gccgccctcatcacggccgtgggcgtgcggctccgaggagaagtgcccccaagcagctaa

DBGET integrated database retrieval system