KEGG   Trichechus manatus latirostris (Florida manatee): 101359308
Entry
101359308         CDS       T05135                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04630  JAK-STAT signaling pathway
tmu04640  Hematopoietic cell lineage
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101359308
   04151 PI3K-Akt signaling pathway
    101359308
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101359308
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101359308
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101359308
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101359308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:tmu04050]
    101359308
   04090 CD molecules [BR:tmu04090]
    101359308
Cytokine receptors [BR:tmu04050]
 Interleukin receptor families
  IL3 receptor family
   101359308
CD molecules [BR:tmu04090]
 Proteins
  101359308
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101359308
NCBI-ProteinID: XP_023595235
UniProt: A0A2Y9RUA4
LinkDB
Position
Unknown
AA seq 380 aa
MSVIWLSVFLMPVSCLLERDPDPNAPISNIRVDPRRGRVSWDLNGSVAEITCSIGSVYTS
KANNNTYCQFYAFSLCKTTNYTIRVTSGPPFSTLLQYPKPDGKPGAAAENLTCWIHDVDF
LECSWAVGRAAPWDVQYHLYLIQPDTYEEWECVHYTTDTQGRRTGCCFDDISGLKNHHYH
FLVNGTSEASRIPCTEIFATLSEIEILAPPSISGTCNKSYSLMEWKMSSHFSSDFVYELQ
IYKGADPTHLDTHTVIDKNSYELVNPGTYTARIRGKNNLGYFGETWSSWSPPRSFECDND
RSLGAWPMMLSIVLGTLLTVLLVVLLCRRFSVVQKIFPPVPGIRDPIKDFFHNNRLVDWE
AGAEGWQECSVEEVQAVGET
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtccgttatctggctttcagtgtttctgatgccggtcagctgcctgctggaaagggac
cccgatccaaatgcgccaattagcaacatcagggtggatccgagacggggaagagtgtcc
tgggacctcaacggaagcgtcgctgaaattacgtgctccataggctcagtttataccagc
aaggcaaacaacaacacctactgccagttttatgcattttctctgtgcaaaacgaccaac
tataccataagagtgacaagtggcccgcccttctccactctgcttcagtatcctaagcca
gatgggaagccgggggcagctgcggaaaatctgacctgctggatccatgatgtggacttt
ctggaatgcagctgggctgtgggcagagcggccccctgggacgtccagtatcacctgtac
cttatccaacccgatacctatgaagaatgggaatgcgtgcattataccacggatacgcag
ggaagacgcactggctgttgttttgacgacatctctggactgaaaaatcatcactaccac
ttcctggtgaatggaactagcgaggcctccagaatcccgtgcaccgagatctttgccact
ttatcagagattgagatactggctccacccagcatcagtgggacgtgcaataagtcatac
tcccttatggagtggaaaatgtcgagccacttcagttccgactttgtctatgagcttcag
atatacaagggtgcagatcccacccacctagacacgcacactgtgatagacaaaaactcc
tacgagcttgtgaatcccgggacgtacacggcaaggatccgaggcaagaacaacctgggc
tactttggggagacgtggagcagctggagcccaccccggagttttgagtgtgacaacgac
aggagtctcggggcctggccaatgatgctgtccatagtgctggggacactcctcaccgtc
ctgctcgtggtgctgctctgcaggaggttctctgtggtccagaaaatcttccctccagtc
cctgggataagagaccccatcaaggacttctttcataacaacaggctggtggactgggaa
gccggcgcagagggctggcaagagtgctcagtggaagaagtgcaggctgtgggggagaca
taa

DBGET integrated database retrieval system