KEGG   Trichechus manatus latirostris (Florida manatee): 101359380
Entry
101359380         CDS       T05135                                 

Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04390  Hippo signaling pathway
tmu04810  Regulation of actin cytoskeleton
tmu05200  Pathways in cancer
tmu05218  Melanoma
tmu05224  Breast cancer
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101359380
   04014 Ras signaling pathway
    101359380
   04015 Rap1 signaling pathway
    101359380
   04390 Hippo signaling pathway
    101359380
   04151 PI3K-Akt signaling pathway
    101359380
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101359380
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101359380
  09162 Cancer: specific types
   05226 Gastric cancer
    101359380
   05218 Melanoma
    101359380
   05224 Breast cancer
    101359380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tmu04052]
    101359380
   00536 Glycosaminoglycan binding proteins [BR:tmu00536]
    101359380
Cytokines and growth factors [BR:tmu04052]
 Growth factors
  Growth factors (RTK binding)
   101359380
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101359380
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101359380
NCBI-ProteinID: XP_004381189
UniProt: A0A2Y9DUC3
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKGTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacagccctgaccgagaagtttaacctgccacca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcttgaggatc
cttccagatggcacagtggatggcaccagggacaggagtgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagggcaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttt
ctggaaaggctggaagaaaaccattacaacacctacatatccaagaagcatgcagagaag
aattggttcgttggtctcaagaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system