KEGG   Trichechus manatus latirostris (Florida manatee): 101359647
Entry
101359647         CDS       T05135                                 

Definition
(RefSeq) pericentriolar material 1 protein isoform X1
  KO
K16537  pericentriolar material 1 protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101359647
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     101359647
SSDB
Motif
Pfam: PCM1_C GidB IBN_N
Other DBs
NCBI-GeneID: 101359647
NCBI-ProteinID: XP_023592989
UniProt: A0A2Y9RM26
LinkDB
Position
Unknown
AA seq 2122 aa
MATGGDPFEEGMNDPDLASWSNEMVDDRLNNMDWSGQQKKANRSSEKNKKKFGVEGDKRV
TNDISPESSPGVGRRRTKTPHTFPHSRYVTQMSVPEQAELEKLKQRINFSDLDQRSIGSD
SQGRATAANNKRQLSENRKPFNFLPMQINTHKSRDAAASPPRRQAVGAAQCKELFASALS
NDLLQNCQVSEEDGRGEPAIESSQIVSRLVQIRDYISKASSMREDLVEKNERSANVERLT
HLIDHLKEQEKSYMKFLQKILARANEEEDVRTIDSAVGSGSVAESTSLHVDVQSEASDTT
ARDPQQEPVEEIEDLKKQHDLLRRMLQQQEQLRALQGRQAALLALQHKAEQAVAVMDDAE
KAAGTTADHPTAPGRQPARSPLHQRVPLRETTGSLSGISITSELNEELNDLIQRFHNQLR
DSQPPAVPDNRRQAESLSLTREVSQSRNPSVSERSPDEKVQLFSKMRVLQEKKQKMDRLL
GELHTLRDQHLNNSSFVPSAASPLRSVDQRSTSSAPSAPGGLAAVGNGEPTSLTSSVPYP
TAALVSQNESENEGHLNPTEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENTKDE
ETEESEYDSEHESPEPVTNIRNPQVAATWNEVNTNTNAQCISNNKDGRSVNSNCEINNRC
AASMRAPNLPSSLDCRYNREGEHGIHVAPGEEDDEEEEDAEEEGASGASLSSHRSSLVEE
APEDAEFEQKISRLMAAKQKLRQLQDLVAMVQDDDADQGVTSANTSNLDDFYPTEEDTKQ
NPNNTRGIANKTQKDAGVDEKEREQFYEAKLRQQQRELRQLQEERRKLIEIQEKIQALQK
ACPDLQLSATSVGNCPTKNYLPAVTSTPTAHENDTNTGKSVLEPEESSVVDNELWTEMRR
HEMLTVELRQRRKQLEALMAEHQRRQGLAETTSPVAVSVRSDGSENLCTPQQSRTEKTMA
TWGGSTQCALDGEDGDEGGYLSEGIVGTDEEGEEEEQDASSSDSFSVCPPNSVNRNSYNV
KETKNRWKNNRPFSADGNYRPLAKTRQQNVSMQRQENLRWVSELSYVEEKEQWQEQINQL
KKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHLIMHQLNQCYTQLT
WQQNNVQRLKQMLNELLRQESQHPEKPGSKERGSSASHPASPSVFCPFSFPAQPVNLFPL
PGFTNFSSFTPGMNFSPLFPSNFGDFSQNISTRTEQQQPLAQNPSGKTEYMAFPKPFESS
SSAGAEKQRNQKQPEEEVENSRPPWLYDQGGEVEKPFINAGFAASVEKTTNSNRKTHFDS
SRRSRQFDEESLESFSSMPDPIDPTTVTKTFKTRKASAQASLASKDKTPKPKSKRRSSTQ
LKSRVKNIGYESASMSSTCEPCKSRNRHSAQTEEPVQAKAFSRKNHEQLEKIIKYSRSAE
ISSAHARRVPQQANRNACNEAPETGSDFSLFEALRDTIYSEVATLISQNESRPHFLIELF
HELQLLNTDYLRQRALYTLQDIVSRHVSERREKEEQDGKLVNSGTWIASNSELTPSESLA
TTDDETFEKNFERETHKISEQNDADNASVMSVSSNFEPFATDDLGNTVIHLDQALARMRE
YERMKTEAESNPNLRCTCRIIEEEDGAAATTAVNSVEETPVAENHSSQQPASEVSNIPCP
RIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFH
KQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSITVKQRCKR
KIEAAGVIQSYAKEAKRILEGDRGSPAGEIDDEDKDKDETETVRQTQTSEVRDGERPKNG
TSDPSDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQTSLQ
ANTETTEENEPEQVLQHDSEKTADSKNIPTEQEPTIIKDDQAGTPVKPCYLHISENEQPP
SSAARKDSLVTPESWKQPDPLPLPFPEGDTLVPGVKEAKSAQETPESSLAGSPDTESPVL
VNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADIRKKMVEEEQNNNLSGEILRETQ
TEELAGNSQKLKEPETVGAQSI
NT seq 6369 nt   +upstreamnt  +downstreamnt
atggctacaggaggagatccgtttgaggaaggcatgaatgatccggacttagcaagctgg
agcaacgagatggtcgatgaccgactcaataacatggactggagtggccaacagaagaag
gcaaatagatcatcagaaaagaataagaaaaagtttggtgtggaaggtgacaaaagggta
actaatgatatctccccggagtcgtccccaggagtcggaaggcgaagaacaaagactcca
catacgtttccacacagcagatatgtgacgcagatgtccgttccagagcaggcggagtta
gagaaacttaaacagcggataaacttcagtgacttggatcagagaagcattgggagtgat
tctcaagggagagcaacagccgccaacaacaaacgtcagctgagtgagaaccgaaagccc
ttcaactttttgcccatgcagattaacactcacaagagcagagatgctgctgcaagcccc
cccaggagacaagcagtcggagcagcacagtgtaaagagttgtttgcttctgctttgagt
aacgaccttttgcaaaactgtcaagtctctgaagaagacgggagaggagagcctgcaata
gagagcagccagattgtaagcaggcttgttcaaattcgcgactatatttccaaggctagt
tccatgcgggaagatcttgtagaaaaaaatgaaagatctgctaatgttgagcgccttact
catcttatagatcaccttaaagaacaagaaaagtcatacatgaaatttctccaaaaaatc
cttgctagagcaaatgaggaggaggatgttcggactatagactcagctgtgggatctggt
tctgtagctgagagcacatcgctacacgtagatgtgcagtctgaagcttcagataccacg
gccagggaccctcagcaggagcctgtggaggagatagaagatctgaagaagcagcacgat
ctattaagaaggatgttgcagcagcaggaacagctgagagctctgcagggccggcaggct
gctctcctggccctgcagcacaaggcggagcaggctgtggccgtgatggacgatgctgaa
aaggctgcagggaccacagctgaccatcccactgcgccgggcagacagccagctcgctcg
cctttgcatcagagagtacctttacgagaaactacaggtagtctatcaggaatcagtata
acatctgaattaaatgaagaattaaatgatttgattcagcgttttcataatcagctccgt
gattctcagcctccagctgttccagacaatagaagacaggcagaaagtctttcattaaca
agggaggtttcccagagcaggaatccatccgtttcggaacgttcacctgatgagaaagtc
cagcttttcagcaaaatgagagtgctacaggaaaagaaacagaaaatggacagattgctt
ggagaacttcacacacttcgagatcagcatctgaacaattcttcatttgtaccgtctgca
gcctcccctctgaggagtgtggatcagagaagtacatcttccgctccctctgctcctgga
ggcttagcagcagtcggcaacggagagcccactagcctcacgtcgtctgttccttatcca
actgccgctctcgtttctcagaatgaaagtgaaaacgaaggccatctaaacccaactgaa
aaactccagaagttaaatgaagtccgaaagagattgaatgaactaagagaattagttcat
tattacgaacagacatcagatatgatgacagacgctgtgaatgaaaacacaaaagatgaa
gaaactgaagagtcggaatatgattctgagcatgaaagtcctgagcctgtcaccaacatt
cgaaatccacaagtagccgccacctggaatgaagtaaatactaatacgaatgcacagtgc
atttctaataataaggatgggagatcagttaattctaactgtgagattaacaacagatgt
gctgccagcatgagagctccaaacctgccttcttccttagactgtcggtacaatagagag
ggagaacatgggatccacgtggcgccgggtgaggaggatgacgaggaagaggaagatgca
gaagaggagggagccagcggagcttccttgtccagtcataggagcagtctggttgaggag
gctccagaagatgctgaatttgaacagaagatcagtagactcatggctgcaaaacagaag
cttaggcagttacaagatcttgttgctatggtacaggatgatgatgcagatcaaggggtt
acctcagccaatacttcaaacttggatgatttttacccgacagaagaagacaccaaacaa
aatccaaataacactagaggaattgccaacaaaacgcagaaagatgccggagtggatgag
aaggaaagagagcaattctacgaggccaaactacggcagcaacagagagagctcaggcag
ctgcaggaagaaagaaggaaactgattgagatccaagagaaaattcaggccttgcagaag
gcatgtcctgacctacagctgtcagccacaagtgtgggtaattgtcccacaaaaaattat
ctgccagcggttacttcaacaccaactgctcacgaaaatgacactaatacaggcaaatct
gtgttggagcccgaggagtcttcagtggtagataacgagctatggacggaaatgcgaaga
cacgaaatgttaacggtagagctgcggcagagaagaaagcagctggaagctctgatggcc
gagcatcagagacggcagggtctagctgagactacatctccagtcgctgtctcggtcaga
agcgatgggtctgagaacctgtgtacgcctcagcaaagtaggacagaaaaaacgatggca
acttggggaggttctactcagtgtgcgctggatggagaagacggtgatgaaggtggttac
ctttccgaggggatcgttgggacagatgaagagggggaagaggaagagcaagatgccagt
tccagtgacagcttctctgtgtgtcctcctaacagtgtgaatcgtaattcctataacgta
aaggaaactaaaaacaggtggaagaacaatcgtcctttttcagcagatggaaattaccgt
cctttagccaagacaaggcaacagaatgtcagcatgcaacgtcaagaaaaccttcgctgg
gtgtcagaactctcttatgtagaagagaaagaacaatggcaagaacaaattaatcagcta
aagaaacagcttgatttcagcgtcagtatctgtcaaactctgatgcaagatcagcagact
ctgtcttgtctgctgcagactcttctcacgggtccttacagtgtgatgcccagcaatgta
gcctctcctcaggtgcaccttataatgcaccagctgaaccagtgctacacgcagctcacg
tggcagcagaataatgttcagaggttgaagcaaatgttaaatgaacttctgcgccaagaa
agtcagcaccctgaaaaacctggaagcaaggaacgaggcagcagtgcatcacaccctgct
tctcccagtgtgttttgtcccttcagctttccagcacagcctgtaaatctgtttcctcta
cctggatttactaatttttcatcatttacaccaggtatgaatttcagccctttatttcct
tctaattttggagatttttctcagaatatttctacacgcactgaacagcagcagccatta
gcccagaatccttcagggaaaacagaatacatggcttttccaaaaccttttgaaagcagt
tcttctgctggagcagaaaaacaaaggaatcaaaaacagcctgaagaggaggtggaaaac
agtaggccaccatggttatacgaccaaggaggcgaagtggaaaaaccatttattaacgct
ggattcgcagcgtctgtagagaaaactacaaatagtaatcgcaaaactcactttgacagc
agcaggagaagccgccagtttgatgaggagtcgttggaaagctttagcagtatgcctgat
cccattgatcccacaacagtgaccaaaacattcaagacgaggaaagcatccgcacaggcc
agcctggcttctaaagacaaaacccctaaaccaaagagtaagaggaggagttccactcag
ttgaaaagcagagtcaaaaacattgggtatgaaagcgccagtatgtctagcacatgcgaa
ccttgcaaaagtaggaacagacattcagctcagactgaagagcctgttcaggcaaaagca
ttcagcaggaagaaccacgagcagctggaaaaaataataaaatacagtaggtcggcagaa
atatcttcagcacatgctaggagagtaccacagcaggctaacagaaatgcatgcaatgaa
gcgccagaaactgggagtgatttttccctatttgaagctttgcgggataccatttattct
gaagtagcaacgttaatttctcagaacgaatctcgtccacattttcttatcgaactcttc
cacgagcttcagctacttaatacagactacttgagacagagagctttatacacactgcag
gacatagtgtcgagacatgtttcggagcgccgtgagaaagaagagcaagatgggaagttg
gtgaattctggtacctggatagcatccaactcagagctgactcccagtgaaagcctggcc
accaccgatgatgaaacctttgagaagaactttgagagagaaacacataaaataagtgag
caaaacgatgctgataatgctagtgtcatgtctgtatcttcaaatttcgagccttttgca
acagatgatctaggcaacactgtgattcacctagatcaagcattagccagaatgagggag
tatgagcggatgaagacggaggctgagagtaacccgaatctaagatgcacctgcaggatt
attgaggaggaagatggtgctgctgccactactgcagttaacagtgtagaagagactccc
gttgctgaaaatcatagttcacaacagcctgcaagtgaagtttctaacatcccttgtcct
cgaattgacactcagcagctggaccggcaaattaaagccattatgaaagaagtcattcct
tttttgaaggagcacatggatgaagtatgctcttctcagcttctaacttcagtaagacgc
atggttttgacccttacccagcaaaatgatgagagcaaagagttcgtaaagttttttcat
aaacaacttgggagtatattacaggactcacttgcgaaatttgctgggcgaaaactgaag
gactgtggagaggatcttcttgttgagatatctgaagtgttgtttaatgaattggctttc
tttaagctcatgcaagatttggataacaacagtataactgttaaacagagatgcaaaagg
aaaatagaagcagctggagtgatacagtcttatgccaaagaggccaaaaggattcttgaa
ggagatcgtggctcacctgctggagagattgatgatgaagacaaagacaaggacgagact
gagacagtcagacagactcagacgtctgaggtacgtgacggtgaacgccccaaaaatggg
acatctgacccttctgaccaagaggaagatgaagaaagcgaaggatgtccagtgtcgatt
aatttgtctaaagccgaaactcaggctctgactaattatggaagtggagaagatgagaat
gaggatgaagaaatggaagaatttgaagaggggcctgtagatgtccagacttcgcttcag
gccaacactgaaactacagaagaaaatgaacccgagcaggttctacagcatgactccgaa
aaaacagcagacagcaaaaatatcccaacagaacaagaacccactattattaaagatgac
caggctggcactcctgtgaaaccctgttacctccatatctcggaaaatgagcagcctcca
agtagtgctgcccggaaggactcactggtcacccctgaatcatggaagcagcctgaccct
ttgccattaccgttccctgaaggtgacaccttagtgccgggagtcaaagaggcgaaatct
gcccaggaaactcccgagagctctctggcgggcagtcctgacaccgagtctcctgtgtta
gtgaatgactacgaagcagaatctggtaacataagtcaaaaatctgatgaagaagacttt
gtgaaagttgaagatttaccacttaaactgacaatatattcagaggcagatattaggaag
aaaatggtagaagaggagcagaataataatttatctggggaaatactacgtgagacacaa
acggaagaattagctgggaattctcaaaaactgaaagaacctgaaacagtgggagcccag
agtatatga

DBGET integrated database retrieval system