KEGG   Trichechus manatus latirostris (Florida manatee): 101359745
Entry
101359745         CDS       T05135                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04218  Cellular senescence
tmu04310  Wnt signaling pathway
tmu04340  Hedgehog signaling pathway
tmu04371  Apelin signaling pathway
tmu04390  Hippo signaling pathway
tmu04510  Focal adhesion
tmu04530  Tight junction
tmu04630  JAK-STAT signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101359745
   04340 Hedgehog signaling pathway
    101359745
   04390 Hippo signaling pathway
    101359745
   04371 Apelin signaling pathway
    101359745
   04630 JAK-STAT signaling pathway
    101359745
   04068 FoxO signaling pathway
    101359745
   04151 PI3K-Akt signaling pathway
    101359745
   04152 AMPK signaling pathway
    101359745
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101359745
   04115 p53 signaling pathway
    101359745
   04218 Cellular senescence
    101359745
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101359745
   04530 Tight junction
    101359745
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101359745
   04921 Oxytocin signaling pathway
    101359745
   04919 Thyroid hormone signaling pathway
    101359745
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101359745
   05206 MicroRNAs in cancer
    101359745
   05205 Proteoglycans in cancer
    101359745
   05203 Viral carcinogenesis
    101359745
  09162 Cancer: specific types
   05210 Colorectal cancer
    101359745
   05212 Pancreatic cancer
    101359745
   05225 Hepatocellular carcinoma
    101359745
   05226 Gastric cancer
    101359745
   05214 Glioma
    101359745
   05216 Thyroid cancer
    101359745
   05221 Acute myeloid leukemia
    101359745
   05220 Chronic myeloid leukemia
    101359745
   05218 Melanoma
    101359745
   05219 Bladder cancer
    101359745
   05215 Prostate cancer
    101359745
   05213 Endometrial cancer
    101359745
   05224 Breast cancer
    101359745
   05222 Small cell lung cancer
    101359745
   05223 Non-small cell lung cancer
    101359745
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101359745
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101359745
   04934 Cushing syndrome
    101359745
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101359745
   05162 Measles
    101359745
   05160 Hepatitis C
    101359745
   05163 Human cytomegalovirus infection
    101359745
   05167 Kaposi sarcoma-associated herpesvirus infection
    101359745
   05169 Epstein-Barr virus infection
    101359745
   05165 Human papillomavirus infection
    101359745
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101359745
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101359745
NCBI-ProteinID: XP_004383690
UniProt: A0A2Y9DYL8
LinkDB
Position
Unknown
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLQAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAQENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGGTNGFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagcaccagctcctgtgctgcgaggtggagaccatccgccgcgcgtacccagatgcc
aacctcctcaacgaccgggtgctgcaggccatgctcaaggccgaggagacctgcgcgccc
tccgtgtcctactttaagtgcgtgcagaaggagatactgccgtccatgcgcaagatcgtg
gccacctggatgctggaggtttgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactatctggaccgcttcctgtctctggagccggtgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacacagacaactctatccgacccgacgagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggctgccatgaccccgcacgatttc
atcgaacacttcctctccaagatgcccgtggcccaggagaacaagcagatcatccgaaaa
cacgcccagaccttcgtggcgctgtgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggccgccgggagcgtggtggctgcggtgcagggtttgcacctaggtggtacc
aacggcttcctctcctaccaccgcctcacgcggttcctctccaaagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaggccctgctggagtcaagcctgcgc
caggcccagcaacagagcctggaccccaaggctgcagaggaggaggaagaggaagaggag
gtggacctggcctgcacccccaccgacgtgcgggatgtgaacatttga

DBGET integrated database retrieval system