KEGG   Trichechus manatus latirostris (Florida manatee): 101359783
Entry
101359783         CDS       T05135                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04022  cGMP-PKG signaling pathway
tmu04141  Protein processing in endoplasmic reticulum
tmu04151  PI3K-Akt signaling pathway
tmu04211  Longevity regulating pathway
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04668  TNF signaling pathway
tmu04728  Dopaminergic synapse
tmu04911  Insulin secretion
tmu04915  Estrogen signaling pathway
tmu04918  Thyroid hormone synthesis
tmu04925  Aldosterone synthesis and secretion
tmu04926  Relaxin signaling pathway
tmu04927  Cortisol synthesis and secretion
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu05020  Prion disease
tmu05030  Cocaine addiction
tmu05031  Amphetamine addiction
tmu05034  Alcoholism
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101359783
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101359783
   04022 cGMP-PKG signaling pathway
    101359783
   04151 PI3K-Akt signaling pathway
    101359783
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101359783
   04915 Estrogen signaling pathway
    101359783
   04926 Relaxin signaling pathway
    101359783
   04935 Growth hormone synthesis, secretion and action
    101359783
   04918 Thyroid hormone synthesis
    101359783
   04928 Parathyroid hormone synthesis, secretion and action
    101359783
   04925 Aldosterone synthesis and secretion
    101359783
   04927 Cortisol synthesis and secretion
    101359783
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101359783
  09156 Nervous system
   04728 Dopaminergic synapse
    101359783
  09149 Aging
   04211 Longevity regulating pathway
    101359783
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101359783
  09164 Neurodegenerative disease
   05020 Prion disease
    101359783
  09165 Substance dependence
   05030 Cocaine addiction
    101359783
   05031 Amphetamine addiction
    101359783
   05034 Alcoholism
    101359783
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101359783
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101359783
   05161 Hepatitis B
    101359783
   05163 Human cytomegalovirus infection
    101359783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101359783
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101359783
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 YabA GIT_CC Docking HALZ
Other DBs
NCBI-GeneID: 101359783
NCBI-ProteinID: XP_012415286
UniProt: A0A2Y9G1Z4
LinkDB
Position
Unknown
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLNPEDWGLRNCTLYTGLDEVAEEQTQLFRCL
EQDVPFDSSSLDVGMDASPPEPPWDPLPLFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQTPGVGEVLDVKTESLAPPFCLLGDGPTSPFGTVQINVGPTSDDPSDVQTKIEPVSPSS
SINSEASLLSADSPNQALLGEEVLEVKTESPVPPGCLLQDVPTSPFGAVQISMGPSPDGS
SGKALSTRKPPLQPKPVMITTVPLPPRAVPPSTTVLLQHLVQPPPVSPVVLIQGAIRVQP
EGPTPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENATLRRQLEALLAKNSELKLGSGNRKVVCIMIFLLFIAFNFG
PVSISEPPSVPASPRVSGEEPRPRRHLLEFSEQEPALGVAPVQGSSQGPEEPQPSPAGRP
SFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQLWKKLPPVKAVPTQPPGPPERGSVGQLQLYRHPDRSQPEFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGATGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPSNTTRGPLPAPAGSQAHQASHQPLYLSHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctaatgctcctcagcgagattgccgac
ccgacgcgtttcttcacggacaacctgctgaacccggaggactggggtctgcggaactgt
accctgtatactggcctggatgaagtggccgaggagcagacgcagctcttccgttgcctg
gagcaggatgtcccgtttgacagcagctccctggacgtggggatggatgctagtccccct
gaacctccatgggacccccttcctctcttcccagatcttcaggtgaagtctgaaccatcc
tccccctgctcttcctcctccctcagttctgaatcatcacgtctctccacagagccctcc
agccagacccctggtgtaggggaggtgctggatgtgaagacagagtccttagcaccccca
ttctgcctcctgggagatggtccaacatccccatttggaaccgtccagatcaatgtgggc
cctacctctgatgatccctcagatgtacagaccaagatagagcctgtctctccttcttcc
tccatcaactccgaggcttccctgctctcagcagactcccccaaccaggcactcctagga
gaggaggtactggaagtgaagacagagtccccagtccctccagggtgcctcctgcaggat
gtcccgacctccccatttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcaggcaaagccctgtccacacggaagccaccactgcagcccaaacctgtgatgataacc
accgtcccactgccacccagagctgtgcctcctagcaccactgtccttctgcagcacctc
gtccagccacccccggtgtccccagttgtccttatccagggtgctattcgagtccagcct
gaggggccaacccctcctgctccacgacctgagaggaagagtattgtcccagctcctatg
cctgggaactcctgcccaccggaagtggatgcaaagctgctgaagcggcagcagcggatg
attaagaaccgggagtcggcctgccagtcccgcaggaagaagaaagagtatctgcagggg
ctggaggcgaggttgcaggcagtgctggccgacaaccagcagctgcgtcgggagaatgct
accctccgccggcagctcgaggccctgctggctaagaacagcgagctcaagttggggtct
ggaaacaggaaggtggtttgcatcatgatcttccttctcttcattgccttcaactttggg
cctgtcagcatcagtgagcctccatcggttccagcctctcctcgagtgagtggggaggaa
cctcggccccggagacacctgctggagttctcagagcaagagccagctcttggagtcgca
cccgtacagggctcctcgcaggggcctgaggagccccagcccagccctgcaggccgaccc
agttttaggaacctgacagccttccccgggggtgccaaggagctgctgctgagagacctg
gaccagctctttctttcctctgattgccgtcactttaaccgaactgagtccctgaggctt
gcggatgagttgagtggatgggtccagcgccaccagagaggcaggcggaagatccctcag
agggcccaggagagacagaagtctcagctatggaagaagttgcctccagttaaggcagtc
cccactcaacccccagggcccccagaaaggggttctgtgggccaactgcagctgtatcgc
cacccagaccgttcccagccggagttcctggatgcaattgaccggcgggaagacacattt
tatgttgtctccttccgaagggatcacttgctgctcccagccatcagccacaataagacc
tctcggcctaagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcgggc
cggggggccacaggggactatgaggagatgatgcagatcgagtgcgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcactccgaaagcagccgtcccca
acccccagcaataccacgaggggccccttgccagctcctgcaggcagccaggcccaccag
gcctcccaccaacccctctacctcagtcacccctga

DBGET integrated database retrieval system