KEGG   Trichechus manatus latirostris (Florida manatee): 101360086
Entry
101360086         CDS       T05135                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04015  Rap1 signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04080  Neuroactive ligand-receptor interaction
tmu04151  PI3K-Akt signaling pathway
tmu04810  Regulation of actin cytoskeleton
tmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101360086
   04072 Phospholipase D signaling pathway
    101360086
   04151 PI3K-Akt signaling pathway
    101360086
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101360086
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101360086
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360086
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tmu04030]
    101360086
G protein-coupled receptors [BR:tmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101360086
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 zf-UBR Rax2
Other DBs
NCBI-GeneID: 101360086
NCBI-ProteinID: XP_004384424
UniProt: A0A2Y9E145
LinkDB
Position
Unknown
AA seq 351 aa
MFTMSHCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTAHLSLKGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRIVMLIVVVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTHIFFYVRRRVQRMAEHVSCHPRYQETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDA
EMRRTFRHLLCCLCLRRSTHESARYTPSYQTGASTRIMLPENGHPLMDSTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttcaccatgagccactgctactacaatgagaccatcggcttcttctacaacaatagt
ggcaaggagctcagctcccactggcggccaaaagatgtggttgtggtggcgctggggctg
actgtcagcgtgctggtgctgctaacgaacctgctagtcattgcagccatcgcctctaac
cgccgcttccaccagcccatttactacctgcttggcaacctggcggccgctgacctcttt
gctggcgtggcctacctcttcctcatgttccacaccgggccacgcacggcccacctctca
ctcaagggctggttcctgcggcagggcctgctggacacgagcctgacagcgtcggtggcc
acactgctggccatcgccgtggagcggcaccgcagtgtgatggccgtgcaactgcacagc
cgcctgccccgtggccgcatcgtcatgctcattgtagtcgtttgggtggctgcgctgggc
ctgggactgctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgc
atggcgcccctgcttagccgctcctatctggccgtctgggccctgtccagcctactcgtc
ttcctgctcatggtggccgtctacacccacattttcttctatgtgcggcggcgcgtgcag
cgtatggcagagcacgtcagctgccacccccgctaccaggagaccacactcagcctagtc
aagaccgtcgttatcatcctgggagcgttcgtggtctgctggacaccaggccaggtggtg
ctgctcctggatggtctgggctgcaagtcttgcaatgttctggctgtggagaagtatttc
ctactcttggccgaggccaactcactggtcaatgctgtggtgtactcatgccgtgatgct
gagatgcgccgcaccttccgccacctcctctgctgtctgtgtctccgccgatccacccat
gagtccgcccgctatacaccctcttaccagacaggtgccagcacacgcatcatgcttcct
gagaatggacaccccctgatggactccaccctttag

DBGET integrated database retrieval system