KEGG   Trichechus manatus latirostris (Florida manatee): 101360180
Entry
101360180         CDS       T05135                                 

Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04061  Viral protein interaction with cytokine and cytokine receptor
tmu04151  PI3K-Akt signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04672  Intestinal immune network for IgA production
tmu04940  Type I diabetes mellitus
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05162  Measles
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05320  Autoimmune thyroid disease
tmu05321  Inflammatory bowel disease
tmu05330  Allograft rejection
tmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101360180
   04151 PI3K-Akt signaling pathway
    101360180
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101360180
   04061 Viral protein interaction with cytokine and cytokine receptor
    101360180
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101360180
   04660 T cell receptor signaling pathway
    101360180
   04658 Th1 and Th2 cell differentiation
    101360180
   04659 Th17 cell differentiation
    101360180
   04672 Intestinal immune network for IgA production
    101360180
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360180
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101360180
   05321 Inflammatory bowel disease
    101360180
   05330 Allograft rejection
    101360180
   05332 Graft-versus-host disease
    101360180
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101360180
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101360180
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101360180
   05162 Measles
    101360180
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101360180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tmu04052]
    101360180
   00536 Glycosaminoglycan binding proteins [BR:tmu00536]
    101360180
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  Interleukins
   101360180
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Haparin
  Cytokines
   101360180
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 101360180
NCBI-ProteinID: XP_004386908
UniProt: A0A2Y9E495
LinkDB
Position
Unknown
AA seq 174 aa
MALLFKSFLSNLSSLLTATSTPATMFKMQLLSCIVLTLALITNSAPTSSSAKETQQQLEQ
LLLDLRMLLVRVKNYEPRRLSMMFTFKFNMPKKATELKHLQCLVEELKPLEDVLNVAPSK
QNTRELISNINVTALELQGSKTPFMCEYDDKAATIEEFLNNWIAFCQRIISTLT
NT seq 525 nt   +upstreamnt  +downstreamnt
atggctcttttgttcaagagcttcctatcaaacctctcatcactactcacagcaacctca
actcctgccacaatgttcaagatgcaactcttgtcttgcattgtactaacgcttgcactc
atcacaaacagtgcacccacttcaagctctgcaaaggagacacagcaacaactggagcaa
ctactgctggacctacggatgcttctggttagagttaaaaattacgagcctcgcagactc
tccatgatgttcacatttaaatttaacatgcccaagaaggccacagaattgaaacatctt
cagtgtctagtagaagaactcaaacctctggaggacgtgctaaatgtagctccaagcaaa
caaaataccagggaattaatcagcaatatcaatgtaacagctctggagttacagggatct
aaaacaccattcatgtgtgaatatgatgataaggcagcaaccattgaagaattcctgaac
aactggattgccttttgtcaaagaatcatctcaacactgacttga

DBGET integrated database retrieval system