KEGG   Trichechus manatus latirostris (Florida manatee): 101360248Help
Entry
101360248         CDS       T05135                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5 isoform X1
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101360248
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101360248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101360248
NCBI-ProteinID: XP_004380737
LinkDB All DBs
Position
Unknown
AA seq 719 aa AA seqDB search
MAQGLEVAVTDFQTSWNNLQHHTEEISSDRLLVRRGQAFNITLYFINRGFQPGLDNIIFV
ADTGPLPDLTKGTRSVFSLAGRGGPSPWIASLKANGATSLEVSLCAPPTAPVGRYLLKIH
IDSFQGSVTAYQIGEFILLFNPWCPGDAVYLDSEPQRQEYVMNDYGFIYQGNKNWIYLCP
WNYGQFEKNIIDICLQLLDKSLNFQMDPATDCVLRGSPVYISRVVCAMINSNDDNGVLSG
NWSENYSDGINPVEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLTIDEYYDNTGRILENKKKDSVWNFHVWNECWMARKDLPPGYGGWQVVD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTPFAFSMVNADCMSWLVYGGKEQRLHRDT
NTVGNFISTKSIQSDERDDITENYKYKEGSTQERQVFLKALQKLRAGRPQGPHQGDPRPS
RPMTLSQDSPRRLDTPSLRPRDVIQVSLKFKLLDPPNMGQDISFALLAHNMSYQFKDLKV
NLSAQSLLHDGSPLPPFWQDTVFIILSAEEAKTHHCKIPYSQYSQYLSTDKLIRLSALGE
EMSCPEKVLVDKIITLAYPGIVINVLAAAVVGQPLSIQVMFANPLLEHAEDCMLVVEGSG
LFKKQQRILIGILKPQHQASITLETVPFKSGQRQIQANLRSNKFKDIKGYRNVYVGVGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagggctggaggtggccgtcacggacttccaaacctcctggaacaacctgcag
caccacactgaggagatcagctctgaccgcctccttgttcgccggggccaggccttcaac
atcacgttgtacttcataaaccggggcttccagccaggcctggacaacatcatctttgtg
gctgacactggccctctgccggacctgaccaaggggactcgctcagtgttcagcctggca
ggtcgtggtggccccagcccctggattgcatcgctgaaggccaacggggctacctccctg
gaggtgagcctctgcgcccctccaacggcacctgtgggccggtacctcctgaagattcac
attgactccttccaggggtctgtcacagcctatcagattggggagttcatcctgctcttc
aatccctggtgcccaggggatgctgtctatttggacagtgagcctcagagacaggagtat
gtcatgaacgattacggcttcatctaccaagggaacaagaactggatctacctgtgtccc
tggaactatggacagtttgaaaagaacatcatagacatctgcctgcagctgctagacaag
agcctgaacttccagatggacccagccacggactgtgtcctgagaggaagccccgtctac
atcagtagagtggtgtgcgccatgatcaacagcaacgatgacaatggggtgctcagtgga
aactggagcgagaattactcagatggtatcaaccctgtggagtggaccggcagtgtggcc
atcctgaagcagtggcacgccacaggctgccagccagtgcgctacgggcagtgctgggtc
tttgctgctgtcatgtgcacagtgatgaggtgcctggggatccctacccgcgtgatcacc
aactttgactctggccacgacacagatgggaacctgaccatagatgagtattatgacaac
acaggcaggattctggagaataagaagaaggattctgtctggaatttccatgtctggaac
gagtgctggatggcccgaaaggacctccctcctggatatggaggctggcaggtggtggac
gccacacctcaggagacaagcaacggcctctactgctgcggccctgcctctgtcagagcc
atcaaagagggggaagtggacctgaactacgacacgcccttcgccttttccatggtgaac
gctgactgcatgtcctggcttgtctatggagggaaggagcagagacttcaccgggacaca
aatactgtcggcaattttatcagcactaagagcatccagagtgatgaacgggatgacatt
accgagaactacaagtacaaagaaggttccacccaggagaggcaggtgtttctgaaggct
cttcagaagctgagggctggaaggccccaaggtccccaccaaggagatcctcgaccttcc
aggccgatgacactgagccaggacagccctcgaaggttggacacaccttcccttcgaccc
agagatgttatccaggtgtccctgaaattcaagcttctcgacccacccaacatgggccag
gacataagctttgccctgctggcccacaacatgtcgtaccagttcaaggacctcaaggtg
aacttgagtgcccagtccctgctgcatgatggcagccctctgcccccgttctggcaggac
acggtgttcatcatcctctccgctgaagaagcaaagacccatcactgcaaaatcccctat
tcccagtacagccagtacctgtcaacggacaagctgatccgcctcagtgccctgggcgag
gagatgagctgccctgagaaggtgctggtggacaagataatcactttggcctatcctggc
atcgtgattaatgttctagcagctgccgtcgtgggtcagccactctccatacaggtgatg
tttgcaaaccccctcttagagcatgctgaggactgtatgctggtggtggaaggcagcggt
ctcttcaagaagcagcaaagaatcctcatcggaatcctcaaaccccagcatcaggccagc
atcactctggagactgtccccttcaagagtggtcaaaggcagatccaagctaatctgagg
agcaacaaatttaaggacatcaagggttacagaaatgtatatgtaggcgttgggttataa

DBGET integrated database retrieval system