KEGG   Trichechus manatus latirostris (Florida manatee): 101360266
Entry
101360266         CDS       T05135                                 

Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04061  Viral protein interaction with cytokine and cytokine receptor
tmu04151  PI3K-Akt signaling pathway
tmu04380  Osteoclast differentiation
tmu04640  Hematopoietic cell lineage
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101360266
   04014 Ras signaling pathway
    101360266
   04015 Rap1 signaling pathway
    101360266
   04151 PI3K-Akt signaling pathway
    101360266
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101360266
   04061 Viral protein interaction with cytokine and cytokine receptor
    101360266
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101360266
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101360266
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360266
   05202 Transcriptional misregulation in cancer
    101360266
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101360266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101360266
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tmu04090]
    101360266
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101360266
Protein kinases [BR:tmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101360266
CD molecules [BR:tmu04090]
 Proteins
  101360266
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig PSI_PSAK
Other DBs
NCBI-GeneID: 101360266
NCBI-ProteinID: XP_004384956
UniProt: A0A2Y9E0R3
LinkDB
Position
Unknown
AA seq 970 aa
MGPWALLVLLMATAWHGQGIPVIEPQGPELVVEPGTPVTLRCVGNGTVEWDSPISPGWTL
GHEAPSSILTTTNATFRNTGTYHCTESGELSRGDANIHLFVKDPFRPWNILAEEVTVLED
QDALLPCLLTNPELEADVSLVRERGRPVRHDTSYSFLKWRGFTIHKTKYLDSSVYHCSTL
VGGRKVLSIGIQLKVQRVSGPPALKLEPAELVRIQGEAAQIVCSASSVNPAFDVFLQRGD
TKLTVYAATDFHDKHYHNVLTHNLHHVGFQDAGNYSCVATSAQGGSSTSMVFRVVESAYL
NLTSEQNLLQEVSLGEKFNLKVKVEAYPALQGFNWTYLGPFSDQQHSLNFDIIEDTYRYT
STLSLPRLKPSEAGRYSFLARNAGGWKTLTFEIILRYPPEVRVMQTHINGSDALVCEATG
YPRPNVTWLQCWGHTDRCEGAQELVLEGTHPEVLSEEPFHKVTVQSVLAIGSLGHNMTYE
CRAHNWAGNATQAFWPISVEATVHRLKEPLFTPVLVACMSVMALLLLLLVLLLYKYKQKP
KYQVRWKIIESYEGNTYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGL
GKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITE
YCCYGDLLNFLRRKAEAMLGLSPDPGQDPDGVTGYKNIHLEKKCVHRDSGFSSQGVDTYV
EMRPVSTSSSNDSFSEQGLDKEDRRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARN
VLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGI
LLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWDLEPTRRPTF
KQICFLLREQAKVDRKEQDYANLTSSSSSGSSSGGSGSSEPEESSSEHLACCEQGDSSQS
MLQPNNYQFC
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgggcccgtgggctctactggtcctcttgatggccacagcctggcatggtcaggggatc
ccggttatagagccccaaggcccagagctggttgtggagccaggcacaccagtgaccctg
cgatgtgtgggcaatggcacagtggagtgggacagccctatctcgcccggctggaccctg
ggccatgaggcccccagcagcatcctgaccacaaccaatgccaccttccgaaacacgggg
acctatcactgcactgagtctggagaactctcgaggggcgacgccaacatccacctcttc
gtgaaagatccttttcgtccctggaacatcctggcggaggaggtgacagtgcttgaggat
caggacgcactgctgccctgcctgctcactaacccggagctggaggctgatgtctcgctg
gtgcgggagcggggccggcctgtccggcacgacaccagctactctttcttgaagtggcgt
ggcttcaccatccacaagaccaagtaccttgacagctcggtctaccactgcagcaccctg
gtgggtggcaggaaggtgctgtccatcggcatccagctcaaggtgcagagagtctcaggg
cccccggccttgaagctggagcctgcggagctggttcggattcaaggggaggctgcccag
atcgtgtgctcagccagcagcgtgaaccccgcctttgacgtcttcctccaacgtggagac
accaagctgacagtctatgcagcaactgacttccatgataagcattaccataacgtcctg
acccacaacctacatcacgtaggcttccaagatgctggcaactactcctgcgtggccacc
agtgcccagggtggcagctccacctccatggtcttccgggtggtagagagtgcctacttg
aacttgacctctgagcagaacctcctccaggaggtgagcttgggtgagaagttcaacctc
aaagtcaaggtggaggcctacccggctctgcaaggctttaactggacctacctgggaccc
ttctctgaccagcagcacagcctcaattttgacatcatcgaggacacatacaggtacacc
tccaccctctccctgccccgcctgaagccctctgaggctggccgctactctttcctggcc
agaaacgcgggaggctggaaaactttgacctttgaaattatccttcgataccccccagag
gtaagggtcatgcagacccacatcaatggctctgatgccctggtctgtgaagccactggg
tacccacggcccaacgtaacgtggctacagtgctggggccacactgatagatgtgagggg
gcccaggagctggtcttggagggcacgcaccctgaggttctaagcgaggagcccttccat
aaggtgactgtccagagcgtgctggccattggaagcctgggacacaacatgacctatgag
tgcagggcccacaactgggcagggaatgccacccaggccttctggcccatctctgtcgaa
gccactgtacatcgccttaaggagcccctcttcacaccggtgctggttgcctgcatgtcg
gtcatggccttgctgctactgctgctcgtgctgcttctgtacaagtacaagcagaagccc
aagtaccaggtgcgctggaagatcatcgagagctatgagggcaacacttacaccttcatc
gaccccacccagctgccctacaatgagaagtgggagtttccccgaaacaacttgcagttt
ggtaagaccctcggagctggtgcctttgggaaggtggtggaggccacggcctttggtctg
ggcaaggaagatgctgtcctgaaggtggctgtgaagatgctgaagtccacggctcacgct
gacgagaaggaggccctcatgtcggaactgaagatcatgagtcacctgggccagcatgag
aacatagtcaaccttctaggagcctgtacacatggaggccctgtcctggtcatcactgaa
tactgttgctatggcgacctgctcaacttcctgcgccgaaaggctgaggccatgctggga
ctcagcccggacccaggccaggaccctgatggggtcactggctacaagaacatccatctg
gagaagaaatgtgtccacagggacagcggcttctccagccagggtgtggacacctatgtg
gagatgaggcctgtctccacttcatcttcaaatgactccttctctgagcaaggcctggac
aaggaagacaggcggccactggagctcagagacctgctccacttctcaagccaagtggcc
caggggatggccttcctcgcttccaagaattgcatccaccgggatgtggcagcccgaaac
gtgctgttgaccagtgggcatgtggccaagattggggactttgggctggctagggacatc
atgaatgactccaactacattgtcaagggcaacgcccgcctgcctgtgaaatggatggct
ccagagagcatcttcgactgtgtatacacggttcagagtgacgtctggtcttatggcatc
ctcctctgggagatcttctcacttggtttgaacccctaccctggcatcctggtgaacagc
aagttctacaaactggtgaaggatggttaccaaatggcccagcctgcgtttgccccaaag
aatatatacagcatcatgcaggcctgctgggacctggagcccacccgcagacccactttc
aagcagatctgcttcctccttcgggagcaggccaaagtggacaggaaagagcaggactac
gccaacctgaccagcagcagcagcagcggcagcagcagtggtggcagcggcagcagcgag
ccagaggaaagctcaagtgagcacctggcctgctgtgagcaaggggatagttcccagtca
atgctgcagcccaacaactaccagttctgctga

DBGET integrated database retrieval system