KEGG   Trichechus manatus latirostris (Florida manatee): 101360273
Entry
101360273         CDS       T05135                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04151  PI3K-Akt signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04934  Cushing syndrome
tmu05162  Measles
tmu05165  Human papillomavirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101360273
   04066 HIF-1 signaling pathway
    101360273
   04068 FoxO signaling pathway
    101360273
   04151 PI3K-Akt signaling pathway
    101360273
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101360273
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360273
   05202 Transcriptional misregulation in cancer
    101360273
   05206 MicroRNAs in cancer
    101360273
   05203 Viral carcinogenesis
    101360273
  09162 Cancer: specific types
   05226 Gastric cancer
    101360273
   05220 Chronic myeloid leukemia
    101360273
   05215 Prostate cancer
    101360273
   05222 Small cell lung cancer
    101360273
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101360273
   04934 Cushing syndrome
    101360273
  09172 Infectious disease: viral
   05162 Measles
    101360273
   05169 Epstein-Barr virus infection
    101360273
   05165 Human papillomavirus infection
    101360273
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101360273
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101360273
NCBI-ProteinID: XP_004387382
UniProt: A0A2Y9E546
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEMEKGSLPEFYHRPPRPPKGACKVPTQESQDVSANRQAVPLIG
SQANSEDTHLVDPKTDTADSQTGLAEQCAGVRKRPAADDSSTQNKRANRTEENVSEGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctcgagcggatggacgccagacag
gcggagtaccctaaaccctccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ttgactcgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggaggggaaatacgagtggcaagagatggaa
aagggcagcttgcccgagttttaccacagacccccgcggccacccaaaggcgcctgcaag
gtgccgacacaggagagccaggatgtcagcgcgaaccgccaggcagtgccgttaataggg
tctcaggcaaactcagaggacacacatttggtagacccaaagactgacacagcagacagc
cagacgggcttagcggagcagtgcgcgggggtacggaagcgacctgcagcagacgattcc
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagaaggttccccgaat
gccggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system