KEGG   Trichechus manatus latirostris (Florida manatee): 101360425
Entry
101360425         CDS       T05135                                 

Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101360425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101360425
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tmu03310]
    101360425
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101360425
Nuclear receptors [BR:tmu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101360425
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101360425
NCBI-ProteinID: XP_004381194
UniProt: A0A2Y9DU07
LinkDB
Position
Unknown
AA seq 777 aa
MDSKGSLKPSIREETLSSVVGQERGNVMDFYKTLRGGATVKVPASSPSLAAASQSDSKQQ
RLLVDFPKGSVHNEQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLSKSTSVPENSKSSASAAVSAAPTEKEFPKTHSDLSSEQQNLKGQSGTNGG
SVKLYTTDQSTFDILQDLEFSSGSPSKETNENPWKSDLLIDENGLLSPLAAEDEPFLLEG
NPNEDCKPVLLPDTKPKIKDNGDFILSSPSSVPLPQVKTEKEDFIELCTPGVIKQEKLGP
VYCQSTFSGANIIGNKTSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPISV
GSENWNRCQASGDDSLTSLGTLNFPGRSVFSNGFSSPGMRPDVSSPPSSSSTAMGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQTTTGVSQETSENPVNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSTVPDTTWRILTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQAGGSLLCFAPDLIINEQRMHLPYMYDQCKHMLYVSSELQRLQVSY
EEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLTEIISNQIPKYSNGKIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaaggatcattaaaaccctccattagagaagaaaccctcagcagtgtggtt
ggtcaggagagaggaaatgtgatggatttctataaaaccctaaggggaggagctactgtg
aaggttcctgcatcttcaccctcactggctgctgcttcacagtcagactctaagcagcaa
agacttttggttgattttccaaaaggctcagtacacaatgagcagcaaccagatctgtcc
aaagcagtttcactctcaatgggattgtatatgggagagacagaaacaaaagtgatgggt
aatgacttgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcagtaagtcgaccagtgttccagagaactcc
aagagttcagcatctgctgctgtttctgctgcccccacagaaaaggagtttccaaaaact
cactctgatctgtcttcagaacagcaaaatttgaagggccagagtggcaccaacggtggc
agtgtgaagttgtataccacagaccaaagcacctttgacattttgcaggatttggagttt
tcttctgggtccccaagtaaagagacaaatgagaacccttggaaatcagacctcttgata
gatgaaaacggcttgctttctcctttggcagccgaggatgagccattccttttagaagga
aacccgaatgaggactgtaagcctgtccttttaccagacacgaaacctaaaattaaggat
aatggagattttatcttatccagccccagcagcgtgccactgccccaagtaaaaacagaa
aaagaagatttcattgaactgtgtactcctggggtaattaagcaggagaaactgggccca
gtttactgtcagtcaaccttttctggagcaaatataattggtaataaaacatctgccatt
tctgttcatggtgtgagtacttctgggggacagatgtaccactatgacatgaatacagca
tccctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaatttctgtt
ggttccgaaaattggaataggtgccaagcatctggagatgacagcctgacttctttgggg
actttgaacttccctggtcgatcagttttttctaatggcttttcaagccccggaatgaga
ccagatgtaagctctcctccatccagctcttcaacagcaatgggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcgggatgtcattatggggtcctaacttgtggaagc
tgtaaagtgttcttcaaaagagcagtggaaggacagcacaattatctttgtgctgggaga
aatgactgtatcattgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaagctggaatgaacctggaagctcgaaaaaccaagaaaaaaataaaaggaatc
cagcagaccaccacaggagtctcacaagaaacgtctgaaaatcccgttaacaaaacaata
gttcctgcaacattgccacaactcacccctactctggtgtcactattggaggtcattgaa
cctgaggtgttatatgcgggatatgacagcactgttcctgatacgacttggcgaatcctg
accacactcaacatgttaggtgggcggcaagtgattgcagcagtgaaatgggcaaaggcg
ataccaggattcaggaacttacacctggatgaccaaatgaccctactgcagtactcatgg
atgttcctcatggcatttgccctgggatggagatcatatagacaagcaggtggtagcttg
ctgtgttttgctcctgatctgattattaatgagcagagaatgcatctaccctacatgtat
gaccaatgtaaacatatgctgtatgtttcctctgagttgcagagacttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaagaaggcttg
aagagccaagagctgtttgatgaaattagaatgacctacatcaaagagctgggaaaggcc
attgtcaaacgggaaggaaactctagtcagaactggcagcgattttatcagctgacaaag
ctcttggactccatgcatgaggtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttgactgaaataatcagcaatcag
ataccaaaatattcaaatggaaaaatcaaaaaacttctctttcatcaaaagtga

DBGET integrated database retrieval system