KEGG   Trichechus manatus latirostris (Florida manatee): 101360550
Entry
101360550         CDS       T05135                                 

Definition
(RefSeq) peroxisome proliferator-activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu03320  PPAR signaling pathway
tmu04310  Wnt signaling pathway
tmu05200  Pathways in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101360550
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101360550
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360550
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101360550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101360550
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tmu03310]
    101360550
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101360550
Nuclear receptors [BR:tmu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   101360550
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101360550
NCBI-ProteinID: XP_004389900
UniProt: A0A2Y9EB24
LinkDB
Position
Unknown
AA seq 441 aa
MEQPREEAAEVREEEEKEEVAEAEGAPELNGGPEHSLPSSSYSDLSQSSSPPSLLDQLQM
GCDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGSRHNSQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHMAPFVIHDIETLWQAEKGLVWKQLVNSLPPYKE
ISVHVFYRCQCTTVETVRELIEFAKSIPSFGNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQCI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggagcagccacgggaggaagccgctgaggttcgggaagaggaggagaaagaggaagtg
gcagaggcagaaggagccccagaactcaatgggggaccagagcactctcttccttccagc
agctactcagacctctcccagagctcctcgccaccatcactgctggaccagctgcagatg
ggctgtgatggggcttcaggcggcagcctcaacatggagtgccgggtgtgcggggacaag
gcatcaggctttcactacggcgtccatgcctgcgaggggtgcaagggcttcttccgtcgg
acgatccgcatgaagctggagtatgagaagtgtgagcgcagctgcaagatccagaagaag
aaccgcaacaagtgccagtactgccgcttccagaaatgcctggctctgggcatgtcacat
aatgccatccgctttggccggatgccggaggcagagaagaggaagctggtggcggggctg
acagcaagcgaggggagccggcacaattcacaggtggctgacctgaaggccttctccaag
cacatctataatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgtggcatc
cttaccggcaaggccagccacatggcgccctttgtgatccacgacatcgagacattgtgg
caggcagagaagggcctggtgtggaagcagctggtaaacagcctgccgccctacaaggag
atcagtgtgcacgtcttctaccgctgtcagtgcaccacggtggagaccgtgcgtgagctc
atcgagttcgccaagagcatccccagcttcggcaacctcttcctcaacgaccaggtgacc
ctcctcaaatacggcgtgcatgaggccatctttgccatgctggcctccatcgtcaacaag
gacggactgctggtggccaatggcagtggcttcgtcacccgtgagttcctgcgcagcctc
cgcaagcccttcagcgacatcattgagcccaagtttgagtttgccgtcaagttcaacgca
ctggaacttgatgacagtgacctggctctattcatcgcagccatcatcctatgtggagac
cggccaggcctcatgaatgtgtcacaggtggaggccatccaggacaccatcctgcgtgcc
ctcgagttccacctgcaggccaaccacccggatgcccagtacctcttccccaagctgctg
cagaagatggctgacctgcggcagctggtcaccgagcatgcccagatgatgcagtgcatc
aagaagactgagacagagacctcgctgcaccccctgctccaggagatctataaggacatg
tactga

DBGET integrated database retrieval system