KEGG   Trichechus manatus latirostris (Florida manatee): 101360563
Entry
101360563         CDS       T05135                                 

Definition
(RefSeq) bcl-2-related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04064  NF-kappa B signaling pathway
tmu04210  Apoptosis
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101360563
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101360563
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101360563
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101360563
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101360563
NCBI-ProteinID: XP_004391260
UniProt: A0A2Y9ECD7
LinkDB
Position
Unknown
AA seq 163 aa
MTDCEFGYIYKLVQDYLKYVLQIPQPGAGSSKTSRVLQNVAFSVQKEVEENLKTCLDNFN
VVSTDIAKTIFNQVMEKEFEDGIINWGRIVTIFAFGGILIKKLLREQIVADMYTYKEISF
FVAEFIVKNTAEWIRQNGGWVRAMQVFVIVLYCAIGTDSFLTN
NT seq 492 nt   +upstreamnt  +downstreamnt
atgactgactgtgagtttggatacatttacaagctggtccaggactatctgaagtacgtc
ctgcagataccacaacctggagctggttcaagcaaaacgtccagagtgttacaaaatgtt
gctttctcagttcaaaaagaagttgaagagaatttgaaaacatgcttggacaattttaat
gtcgtctccactgatattgccaaaacaatattcaatcaagtgatggaaaaggaatttgaa
gatggcatcattaactggggaaggattgtgaccatatttgcgtttggaggtattctcatc
aagaaacttctaagagagcaaattgttgcagatatgtatacttacaaggagatttctttt
tttgttgctgagttcatagtgaaaaacacagcagaatggataaggcaaaacggaggctgg
gtacgtgctatgcaagtatttgtcattgttctttactgtgcaataggaactgacagtttc
ctcactaactaa

DBGET integrated database retrieval system