KEGG   Trichechus manatus latirostris (Florida manatee): 101360945
Entry
101360945         CDS       T05135                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04020  Calcium signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04260  Cardiac muscle contraction
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04713  Circadian entrainment
tmu04720  Long-term potentiation
tmu04723  Retrograde endocannabinoid signaling
tmu04724  Glutamatergic synapse
tmu04725  Cholinergic synapse
tmu04726  Serotonergic synapse
tmu04727  GABAergic synapse
tmu04728  Dopaminergic synapse
tmu04742  Taste transduction
tmu04911  Insulin secretion
tmu04912  GnRH signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04924  Renin secretion
tmu04925  Aldosterone synthesis and secretion
tmu04927  Cortisol synthesis and secretion
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05031  Amphetamine addiction
tmu05410  Hypertrophic cardiomyopathy
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
tmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101360945
   04020 Calcium signaling pathway
    101360945
   04024 cAMP signaling pathway
    101360945
   04022 cGMP-PKG signaling pathway
    101360945
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101360945
   04929 GnRH secretion
    101360945
   04912 GnRH signaling pathway
    101360945
   04921 Oxytocin signaling pathway
    101360945
   04935 Growth hormone synthesis, secretion and action
    101360945
   04924 Renin secretion
    101360945
   04925 Aldosterone synthesis and secretion
    101360945
   04927 Cortisol synthesis and secretion
    101360945
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101360945
   04261 Adrenergic signaling in cardiomyocytes
    101360945
   04270 Vascular smooth muscle contraction
    101360945
  09156 Nervous system
   04724 Glutamatergic synapse
    101360945
   04727 GABAergic synapse
    101360945
   04725 Cholinergic synapse
    101360945
   04728 Dopaminergic synapse
    101360945
   04726 Serotonergic synapse
    101360945
   04720 Long-term potentiation
    101360945
   04723 Retrograde endocannabinoid signaling
    101360945
  09157 Sensory system
   04742 Taste transduction
    101360945
  09159 Environmental adaptation
   04713 Circadian entrainment
    101360945
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101360945
   05020 Prion disease
    101360945
   05022 Pathways of neurodegeneration - multiple diseases
    101360945
  09165 Substance dependence
   05031 Amphetamine addiction
    101360945
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101360945
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101360945
   05414 Dilated cardiomyopathy
    101360945
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101360945
   04934 Cushing syndrome
    101360945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tmu04040]
    101360945
Ion channels [BR:tmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101360945
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101360945
NCBI-ProteinID: XP_004381271
UniProt: A0A2Y9DVM8
LinkDB
Position
Unknown
AA seq 2109 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKP
KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNG
TVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLV
IFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDP
ENEDEGMDEEKPRNMSMPTSETESVNTENVPGGDIEGENCGARLAHRISKSKFSRYWRRW
NRFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTA
EMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFK
ITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTF
DNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFL
AIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQQVMEKPAVEETKEEKIELKSI
TADGESPPTTKINMDDLHPSENEDKSPYPNPETAGEEEEEEPEMPVGPRPRPLSELHLKE
KAVPMPEASAFFIFSANNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFR
NHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSS
AINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQ
LFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLVAMMALF
TVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTF
QEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLI
LLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDAL
IVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTL
LWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLL
FRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAII
KKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNTL
SLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDSRSTFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINN
ANNTVLGRFPRPTGYPSTVSTVEGHGPPLSPAIRVQESAWKLSSKRCRSRESQIAMMCQE
EVSQEETYEVKLKEDTECCSEPSLISTEMLSYQDDENRQLTPPEDKRDIRQSPKRGFLRS
ASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPR
PCATPPASPGRGWPPQPIPTLRLEGAESIEKLNSSFPSIHCSSWSGESPSCGGGGSPIRR
SRPVSLTVPSQARAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGTQQSPNGTLLPFVNCRDPGQDRAGGEEDATCGPALECRKSEEELQ
DSRVYVSSL
NT seq 6330 nt   +upstreamnt  +downstreamnt
atgaatgccaacgcggctgcggggctcgcccctgagcacatccccaccccaggggcagcc
ctgtcttggcaggcagccattgatgcagcccggcaggccaagctgatgggcagcgctggc
aacgcgaccatctccacagtcagttccacgcagcggaaacggcaacagtatggcaaaccc
aagaagcagggcagcacgactgccacgcgcccaccccgtgccctgctctgcctgactctg
aagaaccccatccggagggcatgcatcagcatcgttgaatggaaatcatttgaaataatt
attttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaa
gatgattccaacgccaccaattccaacctggaacgagtggaatatctctttctcataatt
tttactgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgct
tacctccgcaacggatggaatttactagattttataattgtggttgtagggctttttagt
gcaattttagaacaagcaaccaaagcagacggggcaaatgctctaggaggaaaaggggct
ggatttgatgtgaaggcgctgagggctttccgagtgctgcgccccttgcggctggtgtcc
ggagtcccgagtctccaggtggtcctgaattccattatcaaggccatggtccccctgctg
catattgccctgctagtgctgtttgtcatcatcatctatgctatcatcggcctggagctc
ttcatggggaagatgcataagacatgctacaaccaggagggcatagcagatgttccagca
gaggatgatccttctccgtgtgctctggagactggccacggacgccagtgccagaacggc
accgtgtgcaagcccgggtgggacgggcccaagcacggcatcaccaactttgacaatttt
gccttcgccatgttgacggtgttccagtgcatcaccatggagggctggacagacgtgctg
tactggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtc
atctttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttcc
aaagagagggagaaggccaaggctcggggagatttccaaaagttgcgagagaagcagcag
ctggaagaggacctaaaaggctacctggactggatcacgcaggcggaagacatcgacccc
gagaacgaggacgaaggcatggatgaggagaaaccccgaaacatgagcatgcctacaagt
gagacggagtccgtcaacacggaaaatgtgcctggaggtgacatcgagggagaaaactgt
ggagccaggctggcccaccggatttccaaatcaaagttcagccgctactggcgccggtgg
aatcggttctgcagaagaaagtgtcgtgccgcagtcaagtctaatattttctactggctc
gtgattttcctggtattcctcaacacactcaccattgcttcagagcattacaaccagccc
cactggctcacagaagtccaagatactgccaataaggcattgctggcccttttcactgca
gagatgctcctgaagatgtacagcctgggcttgcaggcctattttgtgtccctcttcaat
cgcttcgactgcttcattgtgtgtgggggtatcctggagaccatcctggtggagaccaag
atcatgtccccgttgggcatttctgtactgagatgtgtccggctgctgaggatatttaaa
atcacaaggtactggaattccttaagcaacctggtggcatccctactgaactccgtgcgc
tccattgcctccctgctgctgctcctcttcctctttatcatcatcttctccctcctgggg
atgcagctctttggaggaaagttcaactttgatgagatgcagaccaggaggagcacattc
gataactttccccagtctctcctcactgtgtttcagatcctgaccggggaggactggaat
tcggtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtc
tgtatttacttcatcatcctcttcatctgtggaaattatatcctactgaatgtattcttg
gccattgctgtggacaacctggctgatgctgagagcctcacatctgcccaaaaagaagag
gaagaagagaaggagagaaagaagctggccaggactgccagcccagagaaaaaacaacag
gtgatggaaaagccggcagtggaggagaccaaggaggagaaaattgagctgaaatccatt
acagctgatggagagtccccacccaccaccaagatcaacatggatgacctccaccccagt
gaaaatgaggacaagagtccctaccccaacccagaaactgcaggagaagaggaggaggag
gagcctgagatgcctgtgggcccccgtccccgcccactgtctgagctgcaccttaaggaa
aaagcagtgcccatgccagaagccagtgcgtttttcatcttcagcgccaacaacaggttc
cgcctccagtgccaccgcattgtcaatgactcgatcttcaccaacctgatcctcttcttc
attctgctcagcagtatttccctggctgccgaggaccccgtccagcacacctccttcagg
aaccatatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatc
cttaagatgactgcttatggggctttcctccacaagggctctttctgccggaactacttc
aacatcttggacctgctcgtggtcagcgtgtccctcatctcctttggcatccagtccagc
gcaatcaacgttgtgaagatcctgagagttctgcgagtactcaggcccctgagggccatc
aacagggccaaggggctaaagcatgtggttcagtgtgtgtttgttgccatccggaccatc
gggaacatcgtgattgtcaccacgctgctgcagttcatgttcgcctgcatcggggtccag
ctcttcaagggaaagctctacacctgttcagatagttccaagcaaactgaggcagaatgc
aagggtaactacatcacgtacaaggatggggaggttgaccatcccatcatccagccccgc
agttgggagaacagcaagtttgactttgacaatgttctggtggctatgatggccctcttc
actgtctccacttttgaagggtggccagagctgctgtaccgctccatcgactcccacacg
gaagacaagggccccatctacaactaccgcgtggagatctctatctttttcattatctac
atcatcatcattgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttc
caggagcagggggagcaggagtacaagaactgtgagctggacaagaaccagcgacagtgc
gtagaatacgccctcaaggcccggcccctgcggagatacatccccaagaaccagcaccag
tacaaagtgtggtacgtggtgaactccacctactttgagtacctgatgttcgtcctcatc
ctgctcaacaccatctgcttggccatgcagcactacggtcagagctgcctgttcaaaatc
gccatgaacatcctcaacatgctcttcactggcctcttcactgtggagatgatcctgaag
ctcattgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttg
attgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacc
caatgttctccctctatgaacgcagaggagaactcccgtatctccatcaccttcttccgc
ctcttccgggtcatgcgcctggtcaagctgttgagccgtggcgagggcatccggaccctg
ctgtggaccttcatcaagtccttccaggccctgccctatgtggctctcttgatagtgatg
ctgttcttcatctacgctgtgattggaatgcaggtgtttggaaaaattgccctgaatgac
accacagagatcaaccggaacaacaactttcagaccttccctcaagctgtgctgctcctc
ttcaggtgtgccacaggggaggcttggcaggacatcatgctggcctgcatgccaggcaag
aagtgtgccccagagtctgagcccagcaacagcacagaaggggaaacgccttgtggcagc
agctttgcggttttctacttcatcagcttttacatgctctgtgccttcctgatcatcaac
ctctttgtagctgtcatcatggacaactttgactacctgacaagggactggtccatcctt
ggtccccaccatctggatgaatttaaaagaatctgggcagagtatgaccctgaagccaag
ggtcggatcaaacacctagatgtggtgaccctactccggcggattcaacccccactgggt
tttgggaagctctgtcctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcct
ctaaacagtgatgggacggtcatgttcaatgccaccctgtttgccctggtgaggacagct
ctgaggatcaaaacagaagggaacctagaacaagccaatgaggagttgcgggcaataatc
aagaagatctggaagcggaccagcatgaagctcctggaccaagtggtgccccccgcaggt
gatgatgaggtcacggttggcaagttttacgccactttcctgatccaagagtacttccgg
aagttcaagaagcgcaaagagcaggggcttgtgggcaagccttcccagaggaataccctg
tcccttcaggctggcctgcgcacgctgcatgaccttgggcctgagatccgacgggccatc
tctggagatctgacggccgaggaggagctggacaaggcaatgaaggaggccgtgtctgct
gcttccgaagacgacatcttcaggagggccggtggcctgttcggcaaccatgtcagctac
taccaaagtgacagccggagcaccttcccccagaccttcaccacccagcgcccactgcac
atcaacaaggcgggtaacagccaaggcgacaccgagtcgccttcccacgagaaactggtg
gactccactttcacccccagcagctactcgtccactggctccaacgccaacatcaacaat
gccaacaacactgtcctgggccgcttcccccgccccaccggctaccccagcacagtcagc
accgtggagggccatgggccccccttgtctcctgccatccgggtgcaggagtcagcatgg
aagctcagctccaagagatgccgctcccgggagagccagatagccatgatgtgtcaagag
gaggtctctcaggaggagacctatgaagtgaagttaaaggaagacacagagtgctgcagc
gagcccagcctgatctccacagagatgctctcctaccaggatgatgaaaaccgacaactg
acacccccagaggacaaaagggacatccggcaatctccaaagaggggtttcctccgctcc
gcctcactaggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaa
gggggagacatctctcagaagacagtgctgcccttgcatctggttcatcatcaggcattg
gcagtggcgggtctgagcccacttctccagagaagccattcccccaccacgttccccagg
ccgtgtgccaccccccctgcctcgcccggccgaggctggcccccgcagcccatccccacc
ctacggctggagggcgctgagtccatcgagaaactcaacagcagcttcccatccatccac
tgcagctcctggtcgggggagagtcccagctgtggtgggggcggcagccccatccggaga
agccggcctgtctccctcactgtgcccagccaggccagggccccggggaggcagttccac
ggcagcgccagcagtctggtcgaagcggtcttgatttcagaaggactggggcagtttgct
caagatcccaagtttatcgaggtcacaacccaggagctggctgatgcctgcgacatgaca
attgaggagatggagaatgcggctgacaacatcctcagtgggggcacccagcagagcccc
aatggcaccctattaccttttgttaactgcagggacccagggcaggacagggcagggggt
gaagaggatgcaacctgtgggcctgccctggagtgtcgaaagagtgaggaggaactccag
gacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system