KEGG   Trichechus manatus latirostris (Florida manatee): 101361542Help
Entry
101361542         CDS       T05135                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00010  Glycolysis / Gluconeogenesis
tmu00053  Ascorbate and aldarate metabolism
tmu00071  Fatty acid degradation
tmu00260  Glycine, serine and threonine metabolism
tmu00280  Valine, leucine and isoleucine degradation
tmu00310  Lysine degradation
tmu00330  Arginine and proline metabolism
tmu00340  Histidine metabolism
tmu00380  Tryptophan metabolism
tmu00410  beta-Alanine metabolism
tmu00561  Glycerolipid metabolism
tmu00620  Pyruvate metabolism
tmu01100  Metabolic pathways
Module
tmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101361542
   00053 Ascorbate and aldarate metabolism
    101361542
   00620 Pyruvate metabolism
    101361542
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101361542
   00561 Glycerolipid metabolism
    101361542
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101361542
   00280 Valine, leucine and isoleucine degradation
    101361542
   00310 Lysine degradation
    101361542
   00330 Arginine and proline metabolism
    101361542
   00340 Histidine metabolism
    101361542
   00380 Tryptophan metabolism
    101361542
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101361542
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101361542
    1.2.1.8  betaine-aldehyde dehydrogenase
     101361542
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101361542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101361542
NCBI-ProteinID: XP_004384346
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MWRFPFACCLHTAKRSKFSAPWSRPAAFMSSLMINQPQYAWLKELGLREENEGVYNGSWG
GRGEVVTSCCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEVVRQIGDA
LREKIQMLGKLMSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHVLIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIARVLED
NKLPGAICSLTCGGADIGTAMAKDEQVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLNLVIPSAFFAAVGTAGQRCTTTRRLFLHESIYDEVVNKLKKAYEQIRVG
NPWDSDVLYGPLHTKQAVNMFLGAVEEAKKEGGTVVCGGKVMDRPGNYVEPTIVTGLAHD
ASIVHTETFAPILYVFKFKNEDDAFAWNNEVKQGLSSSVFTKDLGRIFRWLGPKGSDCGI
VNVNVPTNGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcttcccttttgcgtgctgtctgcacactgcaaagaggagcaagttctcagct
ccttggagcaggcctgctgccttcatgtccagtctgatgatcaatcagccccagtatgct
tggctgaaagagctggggctccgtgaggaaaacgagggcgtgtataatggaagctgggga
ggccgaggagaggtggttacgagctgttgtcctgctaacaatgagccaatagcaagagtc
cgacaggccagtgtagcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atatgggcagatattcctgctccaaagcgaggagaagtagtaagacagattggtgatgcc
ttgcgggagaagatccaaatgctaggaaagctgatgtctttggagatggggaaaatctta
gtagaaggtgtgggagaagttcaagaatatgtggatatttgtgattatgctgttggctta
tcgaggatgattgggggacccatcttgccttctgaaagacctggccatgtgctcattgaa
cagtggaatcctgtaggcctggttggaatcatcactgctttcaacttccctgtggcggtg
tatggctggaacaatgccattgcaatgatctgtgggaacgtctgcctttggaaaggagct
ccaacaacttccctcattagtgtagctgtcacaaagataatagccagagttctggaggac
aacaaactgcctggtgccatttgttccttgacttgtggtggagcagacattggaacagca
atggccaaagatgagcaggtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtggcccttatggttcaggagaggtttgggagaagtttgttggaactgggaggaaac
aatgccataattgcttttgaggacgcggacctcaacttagtcattccatcagctttcttt
gcggccgtggggacagctggccagaggtgtacaactacgaggcgactgtttttacatgaa
agcatttatgatgaagttgtaaataaacttaaaaaggcgtatgagcagatccgtgttggg
aacccatgggattctgatgttctctatgggccactccacacaaaacaggcggtgaacatg
ttccttggggcagtggaagaagcaaagaaagagggtggcacagtggtctgtggtggcaag
gtcatggatcgccctgggaactatgtagaaccgacaattgtgacaggtcttgcccatgac
gcatctatcgtgcacacagaaacttttgctccaattctttatgtctttaaattcaagaat
gaagacgacgcctttgcgtggaataatgaagtaaaacaggggctttcaagtagtgtcttt
accaaggatttgggaagaatcttccgctggcttggacctaaaggatcagactgtggcatc
gtaaacgtcaatgttccaacgaatggggctgagattggaggtgcatttggaggtgaaaag
catactggtggtggaagggagtctggcagtgatgcctggaaacagtatatgagaagatct
acttgtaccatcaactacagtaaggaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system