KEGG   Trichechus manatus latirostris (Florida manatee): 101361574Help
Entry
101361574         CDS       T05135                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    101361574
Enzymes [BR:tmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101361574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101361574
NCBI-ProteinID: XP_004370408
LinkDB All DBs
Position
Unknown
AA seq 687 aa AA seqDB search
MAEELVLERCDLELETNGRDHHTADLCRERLVVRRGQPFWLTLHFEGRAYEASVDSLTFS
VVTGPAPSTESGTKARFPLSDTMEEGAWAAAVVDQQDSVLTLQFSAPADAPIGLYCLSLE
TSTGYQGSSFVLGHFILLFNAWCPADDVYLDSEEERQEYVLTQQGFIYQGSAKFINSLPW
NFGQFEDGILDICLKLLDINPKFLKNANRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYKDGISPMFWIGSVDILRRWKNYGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNKFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVNWIQQEDGSMQKSVNNSL
VVGLKISTKSVGRDEREDITHTYKYPDGSPEERDAFTRANHLNKLVAKEETGMAMRIRVG
QGMNMGSDFDVFAHITNNTSEDHTCHLLLCARTVSYNGILGPECGTTEVFDLALEPFSEK
SIPLHILYEKYCDCLTQSNLIKVRGLLTEPAANSYLLAERDIYLENPEIKIRILGEPKKN
RKLVAEVSLRNPLTVPLSGCAFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRVDLLPLHVG
RHKLVVNFESDKLKAVKGYRNVIIGPS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaactggtcctggagagatgtgacctggagctggagaccaatggccgtgac
caccacacggccgacctgtgccgggagaggctggtggtgcggcggggccagcccttctgg
ctgacgctgcacttcgagggccgtgcctacgaggccagtgtggacagccttaccttcagc
gtggtgaccggcccagctcccagcactgagtctgggaccaaggcccgcttcccactgtca
gatactatggaggagggcgcctgggcggctgcagtggtagaccagcaggacagcgtcctt
acgctgcaattcagtgccccagccgatgcccccattggcctgtactgcctcagcctggag
acctccaccggctaccagggctccagcttcgtgctgggccacttcatcctgctcttcaac
gcctggtgtccagctgacgatgtgtacctggactcggaggaggagcggcaggagtatgtc
ctcacccagcagggcttcatctaccagggttcagccaagttcatcaacagcttgccttgg
aactttgggcagtttgaagacgggatcctggacatctgcctgaagctcctcgatatcaac
cccaagttcctgaagaatgccaaccgcgactgctcccgccgcagtagccctgtatacgtg
ggccgggtggtgagcggcatggtcaactgcaatgatgaccaaggcgtgctgctgggacgc
tgggacaacaactacaaggatggcatcagccccatgttctggattggcagcgtggacatc
ctgcggcgctggaagaactatggctgccagcaagttaagtatggccagtgctgggtcttc
gctgctgtggcctgcaccgtgcttcggtgccttggcatccccactcgcgtggtgaccaac
tataactcggcccatgaccagaacagcaacctgctcatcgagtacttccgcaacaagttc
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccagacctgcagccaggatacgaggggtggcaggcccttgaccccacg
ccgcaggaaaagagtgaagggacatactgctgtggcccggttccagttcgtgccatcaag
gaaggtgacctgagcaccaagtacgatgcacctttcgtctttgccgaagtcaacgctgac
gtggtgaactggatccagcaggaggatgggtccatgcagaagtctgtcaacaactccctg
gtcgtggggctgaagatcagcacgaagagtgtcggccgtgacgagcgggaagacatcact
cacacctacaagtacccagacgggtccccagaggagagggacgccttcacaagggccaac
cacctgaacaagctggtggcgaaggaggagacaggcatggccatgcggatccgcgtgggc
cagggcatgaacatgggcagtgactttgatgtcttcgcccacatcaccaacaacacctcc
gaggaccacacctgccacctcctgctctgtgctcgcaccgtcagctacaacgggatcctg
gggcccgagtgcggcaccacggaagtgttcgatcttgccctggagcccttctccgagaaa
agcatccctcttcacatcctctatgagaagtactgtgactgcctgacccagtccaacctc
atcaaggtgcgcggcctcctcactgagccagctgccaacagctacctgctggccgagagg
gacatctacctggagaatccagaaatcaagataaggatcctgggagagcccaagaagaac
cgcaagctggtggccgaggtgtccctgaggaacccactcactgtgcccctgtcgggctgt
gccttcaccgtggagggggccggcctgactgaggagcagaagaccgtggagattccggac
cctgtggaggccggggaggaagtcaaggtgagggtggacctgctgccgctccatgtgggc
cgccacaagctggtggtgaacttcgagagtgacaagctcaaggcggtgaagggctaccgg
aatgtcatcatcggcccctcctaa

DBGET integrated database retrieval system