KEGG   Trichechus manatus latirostris (Florida manatee): 101361706
Entry
101361706         CDS       T05135                                 

Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01523  Antifolate resistance
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04137  Mitophagy - animal
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04218  Cellular senescence
tmu04380  Osteoclast differentiation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04622  RIG-I-like receptor signaling pathway
tmu04623  Cytosolic DNA-sensing pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04917  Prolactin signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04926  Relaxin signaling pathway
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05030  Cocaine addiction
tmu05132  Salmonella infection
tmu05133  Pertussis
tmu05134  Legionellosis
tmu05135  Yersinia infection
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05212  Pancreatic cancer
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05321  Inflammatory bowel disease
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101361706
   04014 Ras signaling pathway
    101361706
   04064 NF-kappa B signaling pathway
    101361706
   04668 TNF signaling pathway
    101361706
   04066 HIF-1 signaling pathway
    101361706
   04071 Sphingolipid signaling pathway
    101361706
   04024 cAMP signaling pathway
    101361706
   04151 PI3K-Akt signaling pathway
    101361706
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101361706
  09143 Cell growth and death
   04210 Apoptosis
    101361706
   04218 Cellular senescence
    101361706
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101361706
   04621 NOD-like receptor signaling pathway
    101361706
   04622 RIG-I-like receptor signaling pathway
    101361706
   04623 Cytosolic DNA-sensing pathway
    101361706
   04625 C-type lectin receptor signaling pathway
    101361706
   04660 T cell receptor signaling pathway
    101361706
   04658 Th1 and Th2 cell differentiation
    101361706
   04659 Th17 cell differentiation
    101361706
   04657 IL-17 signaling pathway
    101361706
   04662 B cell receptor signaling pathway
    101361706
   04062 Chemokine signaling pathway
    101361706
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101361706
   04917 Prolactin signaling pathway
    101361706
   04926 Relaxin signaling pathway
    101361706
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101361706
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101361706
  09149 Aging
   04211 Longevity regulating pathway
    101361706
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101361706
   05202 Transcriptional misregulation in cancer
    101361706
   05203 Viral carcinogenesis
    101361706
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101361706
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101361706
   05221 Acute myeloid leukemia
    101361706
   05220 Chronic myeloid leukemia
    101361706
   05215 Prostate cancer
    101361706
   05222 Small cell lung cancer
    101361706
  09163 Immune disease
   05321 Inflammatory bowel disease
    101361706
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101361706
   05022 Pathways of neurodegeneration - multiple diseases
    101361706
  09165 Substance dependence
   05030 Cocaine addiction
    101361706
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101361706
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101361706
   04931 Insulin resistance
    101361706
   04933 AGE-RAGE signaling pathway in diabetic complications
    101361706
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101361706
   05135 Yersinia infection
    101361706
   05133 Pertussis
    101361706
   05134 Legionellosis
    101361706
   05152 Tuberculosis
    101361706
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101361706
   05170 Human immunodeficiency virus 1 infection
    101361706
   05162 Measles
    101361706
   05164 Influenza A
    101361706
   05161 Hepatitis B
    101361706
   05160 Hepatitis C
    101361706
   05168 Herpes simplex virus 1 infection
    101361706
   05163 Human cytomegalovirus infection
    101361706
   05167 Kaposi sarcoma-associated herpesvirus infection
    101361706
   05169 Epstein-Barr virus infection
    101361706
   05165 Human papillomavirus infection
    101361706
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101361706
   05145 Toxoplasmosis
    101361706
   05140 Leishmaniasis
    101361706
   05142 Chagas disease
    101361706
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101361706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101361706
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101361706
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101361706
NCBI-ProteinID: XP_023593974
UniProt: A0A2Y9RPW9
LinkDB
Position
Unknown
AA seq 538 aa
MSRAEPAQATGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYT
GPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLE
QAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNR
APNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGPGWEARGSFSQADVHRQ
VAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYE
TFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSASVPKPAPQPYTFTPSLSTINFEEFSPMI
FSSGQIPSQAPAPVLAQPPAPAPAMASALAQAPAPVPVLAPSPAQAVGPPAPKTSQAGEG
TLTEALLQLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSMAPHAAEPML
MEYPEAITRLVTGSQRPPDPAPAPLGASGLANGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgtcccgtgcagagccggcccaggccaccggcccctatgtggagatcatcgagcagccc
aagcagcggggcatgcgcttccgctacaagtgcgagggccgctccgccggcagcatcccg
ggcgagaggagcactgacaccaccaagacccaccccaccattaagatcaatggctacaca
gggccagggacagttcgcatctccctcgtcaccaaggacccccctcaccggcctcaccct
cacgagctcgtggggaaggactgccgagatggcttctatgaggctgagctctgcccggac
cgctgcatccacagcttccagaacctggggatccagtgcgtgaagaagcgggacctggag
caggccatcagtcagcgcatccagaccaacaacaaccccttccaagttcccatagaggag
cagcgtggggactacgacctcaatgccgtgcggctctgcttccaggtgacagtgcgcgac
ccatcaggcaggcccctccgcctgccgcctgtcctctctcatcccatctttgacaaccgc
gcccctaacactgccgagctcaagatctgcagagtgaaccgaaactccgggagctgtctc
ggcggggatgagatcttcctgctgtgtgacaaggtgcagaaagaggacattgaggtgtgt
ttcacgggaccaggctgggaggcccgaggctccttctcacaagctgatgtgcaccggcaa
gtggccatcgtgttccggacgcccccctatgcagatcccagcctgcaggctcccgtgcgc
gtctccatgcagctgcggcggccttccgaccgggagctcagtgagcccatggaattccag
tacctgccagacacagatgatcgtcaccggattgaggagaaacgcaagaggacatatgag
accttcaagagcatcatgaaaaagagccctttcaatggacccacggacccccggcctcca
ccccggcgcattgctgtgccctcccgcagctcggcttccgtccccaagccagccccccag
ccctacacctttacgccgtccctcagcaccatcaactttgaggagttttcccccatgatc
ttttcttctgggcagatcccaagccaggccccggccccagtcctggcccagcccccagct
cctgccccagccatggcatcagctctagcccaggccccagcccctgtcccagtcctagcc
ccgagccctgctcaggctgtgggcccgccagcccccaagaccagccaggccggggaagga
acgctgacggaagccctgctacagctgcagtttgatgctgacgaagacctgggtgctctg
cttggcaacagcaccgacccagccgtgttcacagacctggcatccgttgacaactctgag
tttcagcagctgctgaaccagggtgtgtctatggccccccacgcagccgagcccatgctg
atggagtaccctgaggctataactcgcctggtaacagggtcccagaggccccccgaccca
gctcccgccccgctgggtgcctcggggcttgccaacggcctcctctcaggggatgaagac
ttctcctccatcgcagatatggacttctcagccctgctaagtcagatcagctcctaa

DBGET integrated database retrieval system