KEGG   Trichechus manatus latirostris (Florida manatee): 101361891
Entry
101361891         CDS       T05135                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu03013  RNA transport
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04211  Longevity regulating pathway
tmu04218  Cellular senescence
tmu04910  Insulin signaling pathway
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05221  Acute myeloid leukemia
tmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101361891
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101361891
   04066 HIF-1 signaling pathway
    101361891
   04151 PI3K-Akt signaling pathway
    101361891
   04152 AMPK signaling pathway
    101361891
   04150 mTOR signaling pathway
    101361891
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101361891
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101361891
  09149 Aging
   04211 Longevity regulating pathway
    101361891
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101361891
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101361891
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101361891
   05163 Human cytomegalovirus infection
    101361891
   05165 Human papillomavirus infection
    101361891
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101361891
Messenger RNA biogenesis [BR:tmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101361891
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 101361891
NCBI-ProteinID: XP_004383457
UniProt: A0A2Y9DZG4
LinkDB
Position
Unknown
AA seq 118 aa
MSGGSSCSQTPSRTIPTTRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLI
ECRNSPVAKTPPQDLPTIPGVTSPASEAPPMEARQNHLQNSPEDKPVCGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccgagccggaccatccccaccactcgccgg
gtggtcctcggcgacggcgtgcagctgccgcccggggactatagcaccacccccggcggc
acactcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctgatt
gagtgtcggaactcacctgtggccaaaacacccccccaggacctgcccaccattcctggg
gtcaccagccctgccagtgaggcacctcccatggaagccaggcagaaccacctacagaac
agtccagaagacaagccagtgtgtggtgaagaatcacagtttgagatggacatttag

DBGET integrated database retrieval system