KEGG   Trichechus manatus latirostris (Florida manatee): 101362054Help
Entry
101362054         CDS       T05135                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101362054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101362054
Enzymes [BR:tmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101362054
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101362054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101362054
NCBI-ProteinID: XP_004383700
UniProt: A0A2Y9RF52
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSDDHLQTPSKLPHTGKDTLKAGRNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPARSSRHFSKSDSLP
HNNPVRFRPTKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARQYFLNKSKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRAGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKTASGKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPVQAGAAGGCLTRHAAREHRQNSARGARARAEGSPCSYVTRR
AVRTRMSLKEASDLKPDPDGVDGLRDGAAAPRADGGEQPAPGLQEEDLAPESAQKGDTKC
PKSDTGMSRKKSRQGKLGKQFAKMEESAPGRDSPGKDSVGPDVPGFHSDQGERSGPGGAP
AGYTDCAPSPVGCSIVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRR
RHDSSSKTNDQEKDGMNSSKISIKLSKDHENDNNLYVAKLNNGFSSGSGSSSTKLKIQLK
RDEEGRGSYAEGLHENGVCCGDTLSLLESRMEVDDYSQYEEESSDESSSSGGGGEEGDYD
DDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctgatgaccatctgcagactccatccaaattaccgcacacgggaaaggacaccctg
aaggctggcagaaatgcagttgagaggaggtcaagcagatgtaatggtaattctggattc
gaaggccagagtcgatatgtaccatcttctggaatgtctgccaaggagctttgtgaaaat
gatgacctagcaactagtttggttcttgatccctatttaggttttcagacccacaaaatg
aacactagcgcctttcctgcgaggagctcaaggcatttttcaaaatcggacagtttgcct
cacaacaaccccgtgaggtttcggcctactaaaggcaggcaagaagaactgaaggaagtg
atagagcgttttaagaaagatgagcacttggagaaagccttcaaatgtttgacttcaggc
gaatgggcacggcagtattttcttaacaagagcaaaatgcaggagaaattattcaaagaa
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgagatattgccttgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctgcttagacatggagagaacgacttcagtgtcatgtattccacgaggaaaaactgt
gctcagctctggcttggtcctgctgccttcataaaccatgattgcagacctaactgcaag
ttcgtctcaactggtcgagacacagcatgtgtgaaggctttgagagatattgaacctgga
gaagaaatttcttgttattacggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggcactggtgcttttaaatccagagcgggactccctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
ctcaaaaagttaggtgacagcagcaaaaattccgacagtcagtctgtcagctctaacact
gatgcagacaccactcaggaaaaaaacaatgcaacttctaatcgaaaatcttcagttggt
gtgaaaaagaacagcaagagcagaacgttaaccaggcagtctatgtcaagaattccagct
tcttccaactctacctcatctaaactaactcacataaataattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactttcaaagataaaattaagaaatcattgcaaacgg
ctggagcaaaagactgcttccggaaaacttgaaatgggaaacttagtacttaaggagcct
aaagtagttctgtacaaaaatctgcccatcaagaaagacaaggagccggagggaccagta
caagctggagcggccggcgggtgcttgacgagacacgcggcgcgagaacacagacaaaac
tccgcgagaggtgctcgggcgcgggccgagggctcgccctgctcttacgtcacgcggcgg
gccgtgcggacgcggatgagcctgaaggaggcctctgacctcaagccggacccagacgga
gtggacggcctccgagacggcgcggcggcaccgcgcgcggacgggggtgagcagccagcc
cccgggctgcaggaggaggacctggctcctgagagcgcgcagaagggggacacgaagtgc
cccaagagtgacactggcatgtcgagaaagaaatcacgccagggaaagcttgggaagcag
tttgccaagatggaagagtctgctccggggcgtgattcgcccgggaaggacagcgtgggg
ccagacgtgccgggcttccattctgaccagggtgagcgcagtggcccagggggtgcgcct
gcgggctacacggactgcgcgccctcgcccgtcgggtgttcgatcgtcacgtcagacagc
ttcaaaacaaaagacagctttaggactgcgaaaagcaagaagaagcggcgaatcacacgg
tatgacgcccagttaatcctggagaacaactctgggattcccaaattgactcttcgcagg
cgtcacgacagcagcagcaagacaaacgaccaagagaaggatgggatgaattcctcaaaa
atcagcatcaagttaagtaaagaccatgaaaatgataataacctctatgtagcgaagcta
aataacggatttagctcaggatcaggcagtagttctacaaaattaaaaatccagctgaaa
cgggacgaggagggtcgggggtcgtacgcagagggccttcatgagaacggggtgtgctgt
ggcgacaccctctctctcctggagtcccggatggaagtcgacgactacagtcagtacgag
gaggagagtagcgatgagtcctcctcctccgggggcggcggggaggagggggactatgat
gacgactttgaggatgacttcatccctcttcccccggctaagcgattgaggctaatcgtc
gggaaggactctatcgatattgacatttcttccaggagaagagaagaccagtctttgagg
ctcaacgcgtaa

DBGET integrated database retrieval system