KEGG   Trichechus manatus latirostris (Florida manatee): 101362068Help
Entry
101362068         CDS       T05135                                 

Definition
(RefSeq) inositol monophosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00562  Inositol phosphate metabolism
tmu01100  Metabolic pathways
tmu04070  Phosphatidylinositol signaling system
Module
tmu_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101362068
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101362068
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     101362068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 101362068
NCBI-ProteinID: XP_023596065
UniProt: A0A2Y9RQV9
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MADSWQECMDYAVTLARQAGEVVRDALKNEMNVMIKSSPADLVTVTDQKVEKMLISAIKA
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFVVNKKMEFG
VVYSCVEDKMYTGRRGHGAFCDGQKLQVSQQEDITKSLLVTELGSSRTPETVRTVLSNME
KLLCIPVHGIRGVGTAAVNMCLVAAGGADAYYEMGIHCWDMAGAGIIVTEAGGVLTDVTG
GPFDLMSRRIIAASSRTLAERIAKEIQIVPFQRDDED
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccgactcttggcaggaatgcatggattatgcggtaaccctggcaagacaagctgga
gaggtggttcgtgatgctctgaaaaatgaaatgaatgtcatgattaaaagttctccggct
gatctggtgactgtaactgaccagaaagttgaaaaaatgctcatctctgccataaaggca
aagtatccatcgcacagtttcattggtgaggagtctgtagcagctggggaaaaaagtatc
ttaactgacaaccccacgtggatcattgaccctattgatggaacaactaacttcgtacat
agatttccttttgtagcggtttctatcggttttgttgtaaataaaaagatggagtttgga
gttgtgtacagctgtgtggaggacaaaatgtataccggcaggagaggacacggtgccttc
tgtgacggtcagaaactgcaggtttcacagcaagaagatattactaaatcactcttagtg
acagaattgggctcttccagaacaccagagactgtcagaactgtcctttctaatatggaa
aaacttctttgcattcctgttcatgggatccggggagttggaacagcagctgttaatatg
tgccttgtggcagctggaggagcagatgcgtattacgaaatgggaattcactgctgggat
atggcaggagctggtattattgttacagaagctggtggtgtgctgacggatgtaacaggt
ggaccttttgatttgatgtcacgaagaataattgctgcaagtagtagaacattagctgaa
aggatagccaaagaaattcagatagtaccttttcaaagagatgatgaagattaa

DBGET integrated database retrieval system