KEGG   Thermotoga maritima MSB8: THMA_0013Help
Entry
THMA_0013         CDS       T03902                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tmw  Thermotoga maritima MSB8
Pathway
tmw00010  Glycolysis / Gluconeogenesis
tmw00020  Citrate cycle (TCA cycle)
tmw00620  Pyruvate metabolism
tmw00633  Nitrotoluene degradation
tmw00640  Propanoate metabolism
tmw00650  Butanoate metabolism
tmw00680  Methane metabolism
tmw01100  Metabolic pathways
tmw01110  Biosynthesis of secondary metabolites
tmw01120  Microbial metabolism in diverse environments
tmw01130  Biosynthesis of antibiotics
tmw01200  Carbon metabolism
Module
tmw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THMA_0013 (porA)
   00020 Citrate cycle (TCA cycle)
    THMA_0013 (porA)
   00620 Pyruvate metabolism
    THMA_0013 (porA)
   00640 Propanoate metabolism
    THMA_0013 (porA)
   00650 Butanoate metabolism
    THMA_0013 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    THMA_0013 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THMA_0013 (porA)
Enzymes [BR:tmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THMA_0013 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: AKE27826
UniProt: G4FGT3
LinkDB All DBs
Position
14138..15316
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaatgcgatg
agacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaagagcgatg
acagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctctttgcg
gaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaacccatg
tatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaaccgtac
agaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacgataaag
tacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatctggatg
ttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagtgtagtt
gtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system