KEGG   Thermotoga maritima MSB8: THMA_0704Help
Entry
THMA_0704         CDS       T03902                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmw  Thermotoga maritima MSB8
Pathway
tmw00010  Glycolysis / Gluconeogenesis
tmw00051  Fructose and mannose metabolism
tmw00562  Inositol phosphate metabolism
tmw01100  Metabolic pathways
tmw01110  Biosynthesis of secondary metabolites
tmw01120  Microbial metabolism in diverse environments
tmw01130  Biosynthesis of antibiotics
tmw01200  Carbon metabolism
tmw01230  Biosynthesis of amino acids
Module
tmw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tmw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THMA_0704
   00051 Fructose and mannose metabolism
    THMA_0704
   00562 Inositol phosphate metabolism
    THMA_0704
Enzymes [BR:tmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     THMA_0704
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THMA_0704
Exosome [BR:tmw04147]
 Exosomal proteins
  Proteins found in most exosomes
   THMA_0704
  Exosomal proteins of colorectal cancer cells
   THMA_0704
  Exosomal proteins of bladder cancer cells
   THMA_0704
  Exosomal proteins of melanoma cells
   THMA_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM Hydrolase IPPT
Motif
Other DBs
NCBI-ProteinID: AKE28471
UniProt: G4FDD5
LinkDB All DBs
Structure
PDB: 

Position
714315..716279
Genome map
AA seq 654 aa AA seqDB search
MEKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHL
GRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFH
PGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSK
VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE
DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET
IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV
NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKKITRKLILAGNWKMHKTISEAK
KFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISP
LMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTF
CVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEMYDE
ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRGVIS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgaccataagagatgttgatctgaaaggcaagagagtcataatgagagtg
gacttcaacgttccagtgaaggatggggtcgttcaggacgacacgagaataagagccgcc
cttccaacgataaagtacgctcttgaacagggtgcaaaggtgatactcctgtcccatctt
ggaaggcccaagggagaaccttcaccagagttcagcctcgcacctgtcgccaaaagactc
tctgagcttcttggaaaagaagtgaagtttgttcccgctgttgtcggtgatgaggtgaaa
aaggccgttgaggagctcaaagagggagaggttctcctccttgaaaacaccagattccac
ccgggagagaccaagaacgatcctgaactcgcgaagttctgggctagcctcgccgatatt
cacgtgaacgatgccttcggaacggcgcacagggcacacgcttccaacgttggaatcgca
cagtttattcccagcgtagcgggattcctcatggaaaaagagataaagttcctttccaag
gtgacttataatccagaaaaaccgtacgttgtggttcttggaggagcaaaggtatctgac
aaaatcggcgtcatcacgaacctcatggagaaagccgacagaattctcataggtggagcc
atgatgttcaccttcctgaaggctcttggcaaagaggttggatcgtccagggttgaagaa
gacaagatcgacctcgcaaaagaactcctcgaaaaagcgaaagaaaagggtgttgagatc
gttcttcccgttgatgccgttatcgctcagaagatcgaacccggtgtggaaaagaaggtt
gtcagaatcgacgacgggatacccgaaggatggatgggcctcgacataggacccgagaca
attgagctcttcaagcagaagctctccgatgcaaaaaccgttgtctggaacgggccaatg
ggagtcttcgaaatagacgatttcgctgaaggcacgaagcaggtcgcacttgcgatcgca
gcgctcacggaaaagggagcgatcaccgttgtgggtggaggagacagcgccgcggcggtg
aacaagttcggtctggaagacaaattctcccacgtttcaacgggcggaggggcttctctc
gaattccttgaaggaaaagaacttcctggtattgccagcatcgcggataaaaaaaaaata
actcgtaaactgatcctcgctgggaactggaagatgcataaaacgatctcggaagcgaaa
aagtttgtgtcgctgctcgtgaacgaacttcacgacgtgaaagagttcgaaatagtggtc
tgtcctccgttcacagctctatctgaagtgggggaaatactctctggtagaaacatcaaa
ttgggagctcaaaacgttttctacgaagaccagggagcgttcaccggggagatttctcct
ctcatgctgcaagagatcggcgttgaatacgtgatcgtgggacattccgagagaaggcgt
attttcaaagaagacgacgagttcataaacaggaaagtgaaagcggtgcttgaaaaaggt
atgactcctattctctgcgttggagaaacactcgaggaaagagagaaagggctcactttc
tgcgttgtggaaaaacaggtgagagaaggtttctacggtctcgacaaagaggaagcaaag
agagtggtaatagcttacgagccagtctgggcaatcgggacaggaagggtggcgacacca
cagcaggcacaggaagtacacgcgttcataagaaagctgctctcagagatgtacgacgag
gaaacagcgggatcgataaggattctctacggtggaagcataaagccggacaatttcctc
ggtctcatcgttcagaaggatatagatggtggtctcgttggaggagcgagtctcaaagag
tctttcatagaacttgcacgaataatgagaggtgtgatttcctga

DBGET integrated database retrieval system