KEGG   Thermotoga maritima MSB8: THMA_1209Help
Entry
THMA_1209         CDS       T03902                                 

Definition
(GenBank) diguanylate cyclase
Organism
tmw  Thermotoga maritima MSB8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF PAS_9 PAS PAS_8 PAS_4 PAS_3 PAS_12
Motif
Other DBs
NCBI-ProteinID: AKE28961
UniProt: Q9X0R6 R4NQR1
LinkDB All DBs
Position
1199421..1201352
Genome map
AA seq 643 aa AA seqDB search
MKKLIWPVLLVGTAFLIIYSFLIGTPLEIHLATRWEIALPRVLFLLGSFLLNTLFSLTGS
YVVLFGSVSLFLGALMNLLEFFFVYPPLFYAVKLIFYVAGSLLLLIGIFRVFLKLKRFTL
MFRGLFEENNDMVIYYDPSGKIVDVNPAAERFLGYTRIELLGKTIEEISKPAEEKVLFQI
LNFSQNGIKTLEREFLSKDGRTILCECKLVPVYEGKKIAMIQEIARPIDDIRKIEDQIRK
ERKRFLTYFNNIPVLSVILREDGTVEDVNEAGCKLLGVNREQLLNKNWFDMFHESFPHET
FERSFKEKMVHEGRIDGRVIRWVFIPLEENRVMVTGLDITELKENLTSLESDKKFYQLLL
DLSKSLLSLGWNDFVFKQYLSPLGEVFGSKSVALYEKKNGNFVLTASLNGSFEEILSRIP
EDIDCENEMLGIPLEYETETFAVLLIGCGKTDERLFEMARLLKNYLELIYWKLKGEERIL
WLAERDSLTGVYNREAFENRLAYLINLSKRYNRKLSFVFIDLDDFKRINDSKGHLVGDRV
LKEFVNRLTSLLRKSDVVGRLGGDEFGIVLPETDRTGAEILMKRIEEHFREPVLVDGELF
SVNFSYGISVFPEDGESVKELLKVADERMYMNKFSKKRGRENV
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcatctggccggtgctcctcgtgggcaccgccttcctgatcatttattct
ttcctgatcggcacccctcttgaaattcacttagcgactcgctgggaaattgcccttccc
agagttctttttcttctcggatcttttttgctgaacactttgttttccctgacaggatcg
tacgtggttcttttcggaagcgtttctttgtttctcggcgcgctgatgaatcttctggaa
tttttctttgtttatccgcctttgttctatgcagtcaaattgatcttttacgtggccggt
tctcttctgcttctaattggaatcttcagagtatttttaaaactgaaaagattcaccctg
atgttcagaggactcttcgaggaaaacaacgacatggtgatatactacgacccatctgga
aagatcgttgatgtgaatccagccgccgagagattcctgggatacacccgcatcgagctt
ctcggaaaaaccatagaggagatttctaagccagctgaagaaaaggtgttgtttcaaatc
ttgaatttttcacagaatgggataaagactctggaaagagaatttctctcaaaggatgga
agaaccattctgtgcgagtgtaaattggttccggtatatgaaggaaagaagatcgctatg
attcaggaaatcgcacgccccatcgatgatataaggaaaatagaggatcagatcagaaaa
gaaagaaaaagattcctcacttatttcaacaacattcccgttttgagtgtgattctgaga
gaagatggaacggttgaagacgtgaacgaagcaggctgcaaacttttgggagtgaacaga
gaacagcttctgaacaaaaactggttcgacatgttccacgaaagttttccacacgaaact
tttgaaagatcgttcaaagaaaaaatggtgcatgaaggtagaatagatggaagagtcata
agatgggtgttcataccccttgaggagaacagagtgatggtgacaggccttgacatcaca
gaattgaaggaaaatctcacatctctggaaagtgacaaaaaattctatcagcttcttctg
gatctttcaaaaagccttctatcgctcggatggaacgatttcgtgttcaaacagtatctt
tctccgctcggtgaagtgttcggttcaaagagtgtggccctgtacgaaaaaaagaacggg
aattttgttctgacagcctctctcaacggttctttcgaagagattttgtccaggataccg
gaagacatagattgtgagaatgaaatgttgggaattcctcttgagtacgaaactgaaact
tttgcagtgcttctcatcggctgtggaaaaaccgacgagagactttttgagatggccaga
cttttgaaaaattacctagaactcatctactggaaattgaagggggaggagaggatcctc
tggcttgccgaacgcgattccctgacgggtgtgtacaacagagaagcgttcgaaaacaga
ctcgcttacctcatcaacctttcaaaaaggtacaacagaaaactctccttcgtcttcatc
gatcttgatgatttcaagcgtataaacgactcaaaaggccacctggttggagatcgagtt
ctgaaggagtttgtaaacagactcacttcgcttctgagaaaatcggatgtagttggtaga
ctaggaggggacgaattcggtatcgtactccctgaaacggatcgaacgggagcggaaatt
ctcatgaagagaatagaagagcacttcagagaacctgttctagtggatggagaattgttt
tcagtgaatttcagctacggtatcagcgtgttccccgaagacggagagagtgtgaaagaa
ctcctgaaggtcgcagatgaaaggatgtacatgaataaattcagcaagaagagggggaga
gagaatgtctga

DBGET integrated database retrieval system