KEGG   Thermotoga maritima Tma200: THMC_0523Help
Entry
THMC_0523         CDS       T03901                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
tmx  Thermotoga maritima Tma200
Pathway
tmx03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:tmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    THMC_0523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tmx03400]
    THMC_0523
Enzymes [BR:tmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     THMC_0523
DNA repair and recombination proteins [BR:tmx03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     THMC_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AKE26432
LinkDB All DBs
Structure
PDB: 

Position
complement(537557..538135)
Genome map
AA seq 192 aa AA seqDB search
MYTREELMEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFV
GRAGMLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDV
IVALGATALSFFVDGKKVSITKVRGNPIDWLGGKKVIPTFHPSYLLRNRSNELRRIVLED
IEKAKSFIKKEG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgtatacaagggaagaactcatggagatagtgtcagaaagagtgaaaaagtgtacggct
tgcccacttcatctgaataggacaaacgttgtcgtaggagaaggaaatctggatacgagg
attgtctttgtgggagaaggaccgggagaggaagaagacaagacgggaagacctttcgtc
ggcagagcgggaatgcttctgacggaactgctcagagaatcaggtatcagaagagaagat
gtttacatatgcaacgttgtgaaatgcaggcctcccaacaacagaacacccactcctgaa
gaacaggcggcatgtggacattttttactcgctcagatcgaaatcatcaacccagatgtg
atagttgctctcggagccacggcgctgtctttcttcgtggatgggaaaaaggtatccata
actaaggtcagaggaaatcccatcgactggctcggaggaaaaaaggtcattccaacattc
catccgagttatctcctgagaaatagaagtaatgaactcagaaggatcgttcttgaggat
attgagaaagcaaaaagtttcataaagaaggagggttga

DBGET integrated database retrieval system