KEGG   Thermotoga maritima Tma200: THMC_1193Help
Entry
THMC_1193         CDS       T03901                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tmx  Thermotoga maritima Tma200
Pathway
tmx00500  Starch and sucrose metabolism
tmx01100  Metabolic pathways
tmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THMC_1193
Enzymes [BR:tmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     THMC_1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AKE27080
LinkDB All DBs
Position
1182632..1185100
Genome map
AA seq 822 aa AA seqDB search
MLEKLPENLKELESLAYNLWWSWSRPAQRLWRMIDSEKWEEHRNPVKILREVSKERLEEL
SKDEDFIALYELTLERFTDYMEREDTWFNVNYPEWDEKIVYMCMEYGLTKALPIYSGGLG
ILAGDHLKSASDLGLPLIAVGLLYKHGYFTQQIDSDGRQIEIFPEYDIEELPMKPLRDED
GNQVIVEVPIDNDTVKARVFEVQVGRVKLYLLDTDFEENEDRFRKICDYLYNPEPDVRVS
QEILLGIGGMKLLKTLKIKPGVIHLNEGHPAFSSLERIKSYMEEGYSFTEALEIVRQTTV
FTTHTPVPAGHDRFPFDFVEKKLTKFFEGFESKELLMNLGKDEDGNFNMTYLALRTSSFI
NGVSKLHADVSRRMFKNVWKGVPVEEIPIEGITNGVHMGTWINREMRKLFDRYLGRVWRE
HTDLEGIWYGVDRIPDEELWEAHLNAKKRFIDYIRESIKRRNERLGINEPLPEISENVLI
IGFARRFATYKRAVLLFSDLERLKRIVNNSERPVYIVYAGKAHPRDEGGKEFLRRIYEVS
QMPDFKNKIIVLENYDIGMARLMVSGVDVWLNNPRRPMEASGTSGMKAAANGVLNASVYD
GWWVEGYNGRNGWVIGDESVLPETEADDPKDAEALYELLENEIIPTYYENREKWIFMMKE
SIKSVAPKFSTTRMLKEYTEKFYIKGLVNREWLERRENVEKIGAWKERILKNWENVSIER
IVLEDSKSVEVTVKLGDLTPNDVIVELVAGRGEGMEDLEVWKVIHIRRYRKENDLFVYTY
TNGVLGHLGSPGWFYAVRVIPYHPRLPIKFLPEVPVVWKKVL
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagaaacttcccgagaacctgaaagagctcgagagccttgcctacaacctctgg
tggagctggtccagacctgctcagagactctggagaatgatcgattcagaaaagtgggag
gaacacagaaatcccgtcaaaatactgagagaagtctcaaaggaaagactggaagaacta
tcgaaagacgaggacttcatcgctctctacgaactgacgctcgagagattcacagactac
atggaaagggaagacacctggttcaacgtgaactatcccgaatgggacgaaaagatagtt
tacatgtgtatggaatacggactgacgaaagcacttccgatctactctggaggactcggt
atccttgccggagaccacctcaaatcagccagtgatcttggccttcctctcatagccgta
ggtcttctttacaaacacgggtatttcactcaacagatagacagtgacggaagacagatc
gagatctttccagaatacgacatcgaagaactcccgatgaaacctctcagggatgaagac
ggaaaccaggtgatcgtagaagtacccatagacaacgatactgtaaaagcgcgtgtgttc
gaggtacaggtcggaagggtgaaactgtatcttctcgacactgacttcgaggaaaacgag
gatagattcagaaagatctgcgactatctctacaatcccgagcctgatgtgagagtttcc
caggaaattctgctcggcattggtggaatgaaactcctgaagactctcaagataaaacct
ggagtcatccacctgaacgaaggtcatcccgctttttcatccctcgaaaggataaagagc
tacatggaagaaggatattccttcaccgaggcccttgagatcgtcagacagaccacagtt
ttcacgacacacacccccgtccccgcaggtcacgacaggttcccgttcgatttcgtggaa
aagaagctgacaaagttcttcgaaggattcgaatccaaagaactgcttatgaaccttgga
aaagacgaagacggaaatttcaacatgacgtatcttgctttgagaacctcctcctttata
aacggagtgagcaaacttcacgctgacgtatcgagaaggatgttcaaaaatgtctggaag
ggagttccggtggaggagatccccattgaaggcatcacgaatggtgtccacatgggaacc
tggatcaaccgcgagatgagaaaactgttcgacaggtacctcggtagagtctggagggaa
cacactgacctcgaaggaatatggtacggagttgacagaatacccgatgaagaactctgg
gaagcgcatctgaacgcaaagaaacgattcatagattacataagagaatccatcaaaagg
agaaacgaaaggcttggaatcaacgaaccactgccggagatcagtgaaaacgtgctcatc
ataggttttgccagaaggttcgcaacttacaagagagccgtcctgctcttcagcgatctg
gaaagactcaagagaattgtcaataattccgagaggccggtttacattgtgtacgctgga
aaggcccacccgagagacgaaggtggaaaggagtttctcagaaggatctacgaagtttca
cagatgcccgatttcaagaacaaaatcatcgtactcgaaaactatgacatcggaatggct
cgactcatggtgtcgggtgttgacgtgtggttgaacaatccaaggaggcccatggaggca
agcgggacaagtggtatgaaagctgcagcgaacggtgttctgaacgcgagtgtatacgat
ggctggtgggttgagggatacaacggcagaaacggatgggtgataggtgatgaaagcgtg
cttccagaaacagaagcggatgatccaaaggatgccgaggctctgtatgagcttctcgaa
aacgaaataatccccacctactacgaaaacagagaaaagtggatcttcatgatgaaagaa
agcataaagagcgtggctccaaaattcagcaccacccgcatgctcaaagagtacacggag
aaattctacataaagggacttgtgaacagggaatggctggagagaagagaaaacgtcgaa
aaaatcggagcctggaaagaaagaatcctcaagaactgggagaatgtttccatagagcgc
attgttcttgaagattcgaagagcgtagaagtaactgtaaaactgggcgatctcacaccg
aacgacgtgatagtcgaacttgtggctggaagaggagagggaatggaagatctcgaagtg
tggaaagtgatacacatcagaaggtacaggaaagagaacgatctattcgtttacacttac
accaatggtgttcttggtcatcttggatctcccggatggttctacgcggtgagagtcata
ccgtaccatcccaggcttcccatcaagttcctgcccgaagtaccggttgtctggaagaag
gttctctga

DBGET integrated database retrieval system