KEGG   Thauera sp. MZ1T: Tmz1t_0232Help
Entry
Tmz1t_0232        CDS       T00804                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00970  Aminoacyl-tRNA biosynthesis
tmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tmz1t_0232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tmz03029]
    Tmz1t_0232
Enzymes [BR:tmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Tmz1t_0232
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Tmz1t_0232
Mitochondrial biogenesis [BR:tmz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tmz1t_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACK53027
UniProt: C4ZMI3
LinkDB All DBs
Position
complement(266539..267999)
Genome map
AA seq 486 aa AA seqDB search
MSRSDWEVVIGLEVHAQLDTASKIFSGASTAFGAEPNRQASAVDIALPGVLPVLNRGAVE
RAIRFGLAIGAHVAEKSVFARKNYFYPDLPKGYQISQMDLPVVVGGTITIRVGEGESAYE
KTVRLTRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTLH
ALVRWIDICDGNMQEGSFRCDANVSVRRKGATEFGTRREIKNLNSFRFLQQAIDYEVQWQ
IDTLEDGGRIEQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLMIAPEWKARVQAE
MPELPGAMKGRFMDDWGLSAYDATTLTASKEVADFYQATVSAAGAALAKPCANWVMGELA
ARLNKAELDVAASPVSPAQLAGLVARIADNTISNAIARKVFEALWNGEGATADEVIDKQG
LRQVTDTGAIEAMIDEVLAANQKSVEEFRAGKEKAFNALVGQVMKASKGKAGPAQVNALL
RKKLGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagccgatccgattgggaagtcgtcatcgggctggaagtccacgcccagctcgacacc
gccagcaagatcttttccggcgccagcaccgccttcggcgccgagcccaaccgccaggcg
agcgcggtggacatcgcgctccccggcgtgctgccggtgctcaaccgcggcgcggtcgag
cgcgcgatccgcttcgggctggcgatcggcgcccacgtggcggaaaagagcgtgttcgcg
cgcaagaactacttctaccccgacctccccaagggctaccagatcagccagatggacctg
ccggtggtagtcggcggcacgatcaccatccgcgtcggcgagggcgagtcggcgtatgag
aagaccgtgcgcctgacccgcgcccacctcgaggaagacgcgggcaagagcctgcacgag
gacttccacggcatgaccggcatcgacctcaaccgcgccggcacgccgctgctcgagatc
gtctccgagcccgacatgcgctcgtccgccgaggccgtggcctatgcgcgcacgctgcac
gcgctggtgcgctggatcgacatctgcgacggcaacatgcaggaaggctcgttccgctgc
gacgccaacgtctcggtgcgcaggaagggcgcgaccgagttcggcacccggcgcgagatc
aagaacctcaactccttccgcttcctgcagcaggcgatcgactacgaggtgcagtggcag
atcgacaccctcgaggacggcggccgcatcgagcaggccaccgtgctgttcgacccggac
acgggcgagacgcgcatgatgcgcagcaaggaagacgcccacgactaccgctacttcccc
gaccccgacctgctgccgctgatgatcgcgccggagtggaaggcgcgcgtgcaggcggag
atgcctgagctgccgggggcgatgaaggggcgcttcatggacgactgggggctgtcggcc
tacgacgcgaccacgctcaccgcctccaaggaagtcgccgacttctaccaggccacggtg
tcggcggccggggccgcgctcgccaagccttgcgccaactgggtcatgggcgaactcgcc
gcccgcctcaacaaggccgagctcgacgtcgccgcctcgccggtgtcgccggcgcagctc
gccggcctggtggcgcgcatcgccgacaacaccatctccaacgccatcgccaggaaggtg
ttcgaagcgctgtggaacggcgagggtgcgacggcggacgaagtcatcgacaagcaaggc
ctcaggcaggtgacggacaccggcgcgatcgaggccatgatcgacgaggtgctggcggcc
aaccagaaatcggtggaggaattccgcgccggcaaggagaaggccttcaacgccctggtc
ggccaggtcatgaaggcgagcaagggcaaggccggccctgcccaggtcaacgcgctgctg
aggaagaagctcggcgcctga

DBGET integrated database retrieval system