KEGG   Thauera sp. MZ1T: Tmz1t_0964
Entry
Tmz1t_0964        CDS       T00804                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tmz  Thauera sp. MZ1T
SSDB
Motif
Pfam: DUF2859 DUF2384
Other DBs
NCBI-ProteinID: ACK53730
UniProt: C4ZN83
LinkDB
Position
complement(1060957..1061490)
AA seq 177 aa
MNHIVLIAAIGLLSTTTVFAQTASAPLIVVEDRGGASALPYYRPLNPQPDKATPPAPMPA
PRAGNTADAEAAMLPVRSTELSPGEVQRRVIRAPGLTALFLIGDDERSRAWLRQRQAALR
ELQAVGLVVNVESATALAELRRLAPGLTLSPASGDDLAQRLGLRHYPVLITSTGVEQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaccacatcgtcctcatcgccgccatcgggctgctgtccacgaccaccgtcttcgcc
cagaccgcctccgcgccgctgatcgtcgtcgaagatcgtggcggcgcctccgcgctgccg
tactaccggccgctgaatccccagccggacaaggccacgccgccggccccgatgccagcc
ccgcgcgcgggcaacacggccgacgccgaagccgccatgctgccggtgcgctcgacggaa
ctgtcgccgggcgaggtgcagcgccgcgtcatccgggcgccgggcctgacggcgctgttc
ctgatcggcgacgacgagcggtcgcgcgcctggctgcggcagcggcaggcggcgctgcgc
gagctgcaggccgtgggcctggtggtcaacgtggaatcggcgacggcactcgcagaactg
cgccgcttggctcccggcctgaccctctcgccggcctccggcgacgacctggcccagcgc
ctgggcctgcgccactacccggtgctcatcacgtccaccggcgtcgagcagtag

DBGET integrated database retrieval system