KEGG   Thauera sp. MZ1T: Tmz1t_1243Help
Entry
Tmz1t_1243        CDS       T00804                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00564  Glycerophospholipid metabolism
tmz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tmz1t_1243
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tmz1t_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like Thi4 GIDA Pyr_redox Pyr_redox_3 FAD_binding_3 GMC_oxred_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACK54002
UniProt: C4ZLU7
LinkDB All DBs
Position
1376092..1377654
Genome map
AA seq 520 aa AA seqDB search
MESVHPHARRRLLARLADARAVDLVVVGGGATGLGCALDAAARGHSVLLVEARDFAAGTS
SRSTKLIHGGVRYLAQGRIGLVREALRERGRLLRNAPALVHPLRFVVPARNLAERLLLRL
GLGAYDALAGRDGLGGCTLLDAAGLHAALPGLREEGLGGGVAFRDAQFDDAGLALALART
ASAHGALLLNHCAAHELVVEDGRLRGVVVREAEGGQAHHVAARAVINATGVWGDTLRRRA
DPAARALLRPSQGVHLVVDADCLPGSDALLVPRTPDGRVLFMIPWCGKVLIGTTDTPRAD
TPAEPEPLAGEVDELLAAAARWLRRPPAREAVRSVFVGLRPLLGEDGGDGASSRLSREHR
VEVSAQGLVSVLGGKWTTYRAMAEQAVDAAEVVGGLARRASPTASLALDCGVCAGEAGEA
DLPGAPPGLPPGVLPGAAAVRRALREDFALSVEDVLARRSRALFLDAAAAAAVAPAVADL
LAAELGWSAQRRAAELATFRALAARYGTRSRTTASSPPSG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtccatccgcacgcccgtcgtcggcttctcgcccgcctcgccgacgcgcgc
gcggtcgacctcgtcgtggtcggcggcggtgccaccgggctgggctgcgcgctcgacgcg
gcggcgcgtggccattcggtgctgctggtggaggcgcgcgacttcgccgccggcaccagc
tcgcgctcgaccaagctgatccacggcggcgtgcgctacctcgcccagggccgcatcggc
ctggtgcgcgaagccttgcgcgagcgcgggcgcctgctgcgcaacgcgcccgcgctggtg
catccgctgcgcttcgtggtgccggcgcgcaacctggcggagcggctcctgctgcgtctc
gggctcggcgcctacgacgcgctagcgggtcgggacgggctgggcggctgcacgctgctc
gacgcagccgggctgcatgcggcgctgcccggattgcgcgaggaggggctgggcggcggc
gtggccttccgcgatgcccagttcgacgacgccggcctggcgctcgcgctggcgcgcacg
gcgagcgcccacggtgcgctgctgctcaaccactgcgccgcgcacgagctggtggtggaa
gacggtcggctgcgcggcgtggtggtgcgcgaggccgagggtgggcaagcgcaccatgtc
gctgcgcgcgcggtgatcaacgccaccggggtgtggggcgacacgctgcgccgacgtgcc
gatccggccgcccgcgcgctgctgcgcccgagccagggcgtgcatctggtggtcgacgcc
gactgtctgcccggcagcgacgcgctgctggtgccgcgcaccccggacggacgcgtgctg
ttcatgattccctggtgcggaaaggtgctgatcggcaccaccgacaccccgcgcgccgat
acgccggcggagcccgagccgctcgcgggcgaggtggacgagctgctggccgccgctgcg
cgctggctgcgtcggccgccggcgcgcgaggccgtgcgcagcgtcttcgtcggcctgcgg
cccttgctcggcgaggatggaggcgatggtgcaagcagccggctctcgcgcgagcaccgc
gtcgaggtctcggcgcagggcctggtcagcgtgctgggcggcaaatggaccacctatcgc
gccatggccgagcaggcggtagatgcggccgaggtggtaggcgggctggcgcggcgggca
tcgccgaccgcctcgctggcgctcgattgcggagtgtgcgcgggggaggcgggcgaggcg
gacttgccgggcgcgcctccggggcttccccccggcgtgctgcccggcgccgcggcggtg
cggcgcgcgctgcgcgaggacttcgccctttccgtcgaggacgtgctcgcgcgccgcagc
cgcgcgcttttcctcgatgccgcggcggccgcggcggtggcgcctgctgtggccgacctc
ctcgcggcggaactcggctggagcgcgcagcggcgcgcggccgagctcgcgaccttccgc
gcgctcgccgcgcgctacggcacgcgcagccgcacgaccgcctccagcccgccgtcgggg
tga

DBGET integrated database retrieval system