KEGG   Thauera sp. MZ1T: Tmz1t_1261Help
Entry
Tmz1t_1261        CDS       T00804                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00020  Citrate cycle (TCA cycle)
tmz00480  Glutathione metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
tmz01210  2-Oxocarboxylic acid metabolism
tmz01230  Biosynthesis of amino acids
Module
tmz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmz1t_1261
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tmz1t_1261
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Tmz1t_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACK54020
UniProt: C4ZLW5
LinkDB All DBs
Position
1392959..1394203
Genome map
AA seq 414 aa AA seqDB search
MSESKIKVPAGGQKIVPGQAVPDNPIIPFIEGDGIGVDITPVMIKVIDAAVDKAYGGKKK
IHWMEVYAGEKSTQIYGPDEWLPKETFDALKTYSVSIKGPMTTPVGGGIRSLNVALRQEL
DLYQCVRPVRYFKGVPSPLKQPELTDMVIFRENTEDIYAGIEWQALSEGAKKVIDFLQGE
MGVRKIRFPATSGIGIKPVSIEGTTRIVRAAIRYAIDNDRKSVTLVHKGNIMKFTEGLFR
DTGYRVAQEEFGAQPIDGGPWCKFKNPRSGREILVKDAIADAFLQQILLRPAEYDVIATL
NLNGDYISDALAAQVGGIGIAPGANISDQYACFEATHGTAPKYAGLDKVNPGSLILSAEM
MLRHLGWKEAADLVIRGMEAAIADKQVTYDFARLMEGANEVSCSEFGDAMIARM
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccaagatcaaggtacccgcaggcggccagaagatcgtcccggggcaggcc
gttccggacaacccgatcatccccttcatcgagggcgacggcatcggcgtcgacatcacc
ccggtgatgatcaaggtgatcgacgcggcggtggacaaggcctacggcggcaagaagaaa
atccactggatggaggtctacgccggcgagaagtcgacgcagatctacggtcccgacgag
tggttgccgaaggagaccttcgacgcactcaagacctactcggtgtcgatcaagggcccg
atgaccaccccggtgggcggcggcatccgctcgctcaacgtggcgctgcgtcaggagctc
gacctctaccagtgcgtgcgtccggtgcgttacttcaagggtgtgcccagcccgctcaag
cagcccgagctgaccgacatggtcatcttccgcgagaacaccgaggacatctacgccggc
atcgaatggcaggcgctgtccgagggcgcgaagaaggtcatcgactttctgcagggcgag
atgggggtcaggaagatccgcttcccggcgacctcgggcatcggcatcaagccggtgtcg
atcgagggcacgacccgcatcgtgcgcgccgcgatcaggtacgcgatcgacaacgaccgc
aagagtgtgaccctggtgcacaagggcaacatcatgaagttcaccgagggcctgttccgc
gacaccggctacagggtggcgcaggaggagttcggcgcgcagccgatcgacggcggcccg
tggtgcaagttcaagaacccgaggagcggtcgcgagatcctcgtcaaggacgcgatcgcc
gacgccttcctgcagcagatcctgctgcgtccggccgagtacgacgtgatcgccacgctc
aacctcaacggcgactacatctcggacgcgctcgccgcgcaggtgggcggcatcggcatc
gcgccgggcgccaacatctccgaccagtacgcctgcttcgaggccacccacggtaccgcg
cccaagtacgccgggctggacaaggtgaacccgggctcgctgatcctgtctgcagagatg
atgctgcgccacctgggctggaaggaggcggccgacctggtgatccggggcatggaggcg
gcgatcgccgacaagcaggtcacctacgacttcgcgcgcctgatggaaggcgccaacgag
gtctcgtgttcggagttcggcgacgcgatgatcgcgcgcatgtag

DBGET integrated database retrieval system